DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)01289 and MPD1

DIOPT Version :9

Sequence 1:NP_001163065.1 Gene:l(2)01289 / 46017 FlyBaseID:FBgn0010482 Length:1786 Species:Drosophila melanogaster
Sequence 2:NP_014931.3 Gene:MPD1 / 854462 SGDID:S000005814 Length:318 Species:Saccharomyces cerevisiae


Alignment Length:117 Identity:23/117 - (19%)
Similarity:53/117 - (45%) Gaps:16/117 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1127 HIEQVNRKMFEKIRKNSDYVAVI-FYSDECKQCPRVLA----EVEHIDDEADKAGIDFVKIDDKQ 1186
            ||.::..|.|:|...|::|.::: ||:..|..|.::.:    ..:.:|.....|.::.....:|.
Yeast    30 HISELTPKSFDKAIHNTNYTSLVEFYAPWCGHCKKLSSTFRKAAKRLDGVVQVAAVNCDLNKNKA 94

  Fly  1187 MAKEYGVFALPAIVFFKPTS---KEPV--------IYAGDLYEEEQILTWLI 1227
            :..:|.|...|.::.|:|..   .:|:        .:|.::|...:.|..::
Yeast    95 LCAKYDVNGFPTLMVFRPPKIDLSKPIDNAKKSFSAHANEVYSGARTLAPIV 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)01289NP_001163065.1 PDI_a_family 50..145 CDD:239259
PDI_a_family 384..479 CDD:239259
Thioredoxin_6 510..689 CDD:404691
ER_PDI_fam 700..>916 CDD:273457
PDI_a_family 1129..1226 CDD:239259 21/112 (19%)
TRX_family 1433..>1502 CDD:239245
MPD1NP_014931.3 ER_PDI_fam 30..>275 CDD:273457 23/117 (20%)
PDI_a_MPD1_like 30..150 CDD:239300 23/117 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.