DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)01289 and TXNDC5

DIOPT Version :9

Sequence 1:NP_001163065.1 Gene:l(2)01289 / 46017 FlyBaseID:FBgn0010482 Length:1786 Species:Drosophila melanogaster
Sequence 2:NP_110437.2 Gene:TXNDC5 / 81567 HGNCID:21073 Length:432 Species:Homo sapiens


Alignment Length:403 Identity:90/403 - (22%)
Similarity:140/403 - (34%) Gaps:112/403 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1289 GGAASAAAAFGSEADPSEAAAGGAEDAPAA-GSEGDSPPASAAAPADAST-GKQEDD------AD 1345
            ||....|.|       .||||..|:..||| |.:|..|.:.....||..| |.|...      |.
Human    30 GGGRWGARA-------QEAAAAAADGPPAADGEDGQDPHSKHLYTADMFTHGIQSAAHFVMFFAP 87

  Fly  1346 GCEQCTKVLEELENIDD---------------DCDKHGITFVKTRDFSVADGYGVHEYPALVYFE 1395
            .|..|.::.....::.|               ||..|.         .|....||..||.|..|:
Human    88 WCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTAHS---------DVCSAQGVRGYPTLKLFK 143

  Fly  1396 GGIPNV-FEGELSEEEEVLQWLITQKTEDRI------------EL------ITRQMLETMVEETQ 1441
            .|...| ::|. .:.:.:..|::....|:.:            ||      ::....|..|.:..
Human   144 PGQEAVKYQGP-RDFQTLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELHVAQGD 207

  Fly  1442 YLAVYFYKINCNIC-------DQILEGLELIDDECDVFGIHMVKI------QDPQLAKRYSIKTF 1493
            :. :.|:...|..|       :|:..|||..:         .|||      |..:|.....::.:
Human   208 HF-IKFFAPWCGHCKALAPTWEQLALGLEHSE---------TVKIGKVDCTQHYELCSGNQVRGY 262

  Fly  1494 PALVYFRNGNPL--------------LFEGDLQ-NEQSVLEWLIDDDNRELADEIE-------EV 1536
            |.|::||:|..:              ..|..|| .|....|.:...:...||.|.|       .:
Human   263 PTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADKGTVLAL 327

  Fly  1537 NERMLDRLMAESTLLVVFFYDDDCAECEEILEELEEIDGEADMFGIDFVKIASIQA------AKK 1595
            .|...|..:||. :..:.||...|..|:.:....||: .:.:..|:..||||.:..      ..|
Human   328 TENNFDDTIAEG-ITFIKFYAPWCGHCKTLAPTWEEL-SKKEFPGLAGVKIAEVDCTAERNICSK 390

  Fly  1596 YEIVNIPSLVYFR 1608
            |.:...|:|:.||
Human   391 YSVRGYPTLLLFR 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)01289NP_001163065.1 PDI_a_family 50..145 CDD:239259
PDI_a_family 384..479 CDD:239259
Thioredoxin_6 510..689 CDD:404691
ER_PDI_fam 700..>916 CDD:273457
PDI_a_family 1129..1226 CDD:239259
TRX_family 1433..>1502 CDD:239245 18/81 (22%)
TXNDC5NP_110437.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..63 11/22 (50%)
PDI_a_ERp46 61..164 CDD:239303 22/112 (20%)
ER_PDI_fam 66..432 CDD:273457 75/360 (21%)
PDI_a_ERp46 190..290 CDD:239303 19/109 (17%)
PDI_a_ERp46 323..424 CDD:239303 21/83 (25%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 429..432
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.