DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(2)01289 and TMX1

DIOPT Version :9

Sequence 1:	NP_001163065.1	Gene:	l(2)01289 / 46017	FlyBaseID:	FBgn0010482	Length:	1786	Species:	Drosophila melanogaster
Sequence 2:	NP_110382.3	Gene:	TMX1 / 81542	HGNCID:	15487	Length:	280	Species:	Homo sapiens

Alignment Length:	136	Identity:	31/136 - (22%)
Similarity:	54/136 - (39%)	Gaps:	27/136 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly  1404 GELSEEEEVLQWLI-----TQKTEDRIELIT----RQMLE--TMVEETQYLAVYFYKINCNICDQ 1457
            |.|:....||..|:     |......:.:||    |::||  .|:|        ||...|..|..
Human     5 GSLAVPLAVLVLLLWGAPWTHGRRSNVRVITDENWRELLEGDWMIE--------FYAPWCPACQN 61

  Fly  1458 ILEGLELIDDECDVFGIHMVKI---QDPQLAKRYSIKTFPALVYFRNGNPLLFEG-----DLQNE 1514
            :....|...:..:...:::.|:   :.|.|:.|:.|...|.:.:.::|....::|     |..|.
Human    62 LQPEWESFAEWGEDLEVNIAKVDVTEQPGLSGRFIITALPTIYHCKDGEFRRYQGPRTKKDFINF 126

  Fly  1515 QSVLEW 1520
            .|..||
Human   127 ISDKEW 132

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(2)01289	NP_001163065.1	PDI_a_family	50..145	CDD:239259
		PDI_a_family	384..479	CDD:239259
		Thioredoxin_6	510..689	CDD:404691
		ER_PDI_fam	700..>916	CDD:273457
		PDI_a_family	1129..1226	CDD:239259
		TRX_family	1433..>1502	CDD:239245	15/73 (21%)
TMX1	NP_110382.3	PDI_a_TMX	29..129	CDD:239292	22/107 (21%)
TMX1	NP_110382.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	218..280
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910