powered by:
Protein Alignment l(2)01289 and tmx4
DIOPT Version :9
Sequence 1: | NP_001163065.1 |
Gene: | l(2)01289 / 46017 |
FlyBaseID: | FBgn0010482 |
Length: | 1786 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001025330.1 |
Gene: | tmx4 / 792311 |
ZFINID: | ZDB-GENE-050706-155 |
Length: | 277 |
Species: | Danio rerio |
Alignment Length: | 72 |
Identity: | 17/72 - (23%) |
Similarity: | 37/72 - (51%) |
Gaps: | 4/72 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 1435 TMVEETQYLAVYFYKINCNICDQILEGLELIDDECDVFGIHMVKI---QDPQLAKRYSIKTFPAL 1496
|::.:.::: :.||...|..|..:....|.:..:.|..||.:.:: |.|.|:.|:.:.|.|.:
Zfish 40 TLILQGEWM-IKFYAPWCPACQHLQADWENLGRQSDSLGISVGRVDVTQQPGLSGRFLVTTLPTI 103
Fly 1497 VYFRNGN 1503
.:.:||:
Zfish 104 FHAKNGD 110
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.