DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)01289 and P4HB

DIOPT Version :9

Sequence 1:NP_001163065.1 Gene:l(2)01289 / 46017 FlyBaseID:FBgn0010482 Length:1786 Species:Drosophila melanogaster
Sequence 2:XP_024306545.1 Gene:P4HB / 5034 HGNCID:8548 Length:546 Species:Homo sapiens


Alignment Length:520 Identity:122/520 - (23%)
Similarity:192/520 - (36%) Gaps:164/520 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   671 IPALYEGDLMNEDEVLEWLLVQKKTATIEEVTDEILVTLINEHEYVVVFFTGPCEPGETCEHT-- 733
            :.||...|...|:   :.:||.:|:...|.:.         .|:|::|.|..|     .|.|.  
Human    11 VAALVRADAPEEE---DHVLVLRKSNFAEALA---------AHKYLLVEFYAP-----WCGHCKA 58

  Fly   734 -----LNALESIDDELDEAGIIFV-TTEDTGIAKKYNVKTYPRLVFFRNRD---PLHFTGDLDDE 789
                 ..|...:..|..|..:..| .||::.:|::|.|:.||.:.||||.|   |..:|.. .:.
Human    59 LAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAG-REA 122

  Fly   790 DEVLAWI---TDDETLEIP-GKIEEVNVKMLDKILAENDHVVV--FFYAEGDKKAQKILNELENI 848
            |:::.|:   |......:| |...|        .|.|:..|.|  ||.......|::.|...|.|
Human   123 DDIVNWLKKRTGPAATTLPDGAAAE--------SLVESSEVAVIGFFKDVESDSAKQFLQAAEAI 179

  Fly   849 DDECEEKDIDFVKTSDDDIDKEYDLPGLPALAFYRHKF---RTIYTGDLMKEEEI-------LEW 903
            |      ||.|..||:.|:..:|.|.....:.|  .||   |..:.|::.||..:       |..
Human   180 D------DIPFGITSNSDVFSKYQLDKDGVVLF--KKFDEGRNNFEGEVTKENLLDFIKHNQLPL 236

  Fly   904 VIDLHESTADVIESVDRKTLQVLINDVEHLAVFFYDDECESCSDILEELENIDDDTDKHGIQFVK 968
            ||:..|.||..|...:.||         |:.:|.    .:|.||...:|.|.             
Human   237 VIEFTEQTAPKIFGGEIKT---------HILLFL----PKSVSDYDGKLSNF------------- 275

  Fly   969 SNDVKLAHEIGIFAFPALVYYETGVPIMYDGNIASNQDVFNWILEQKADQSIQLINRDQLFEYIG 1033
                |.|.|    :|...:.:     |..|.:...||                     ::.|:.|
Human   276 ----KTAAE----SFKGKILF-----IFIDSDHTDNQ---------------------RILEFFG 306

  Fly  1034 TKDFLAVVFYKEDDPDSPRVLRHIELIDDEAAEYGIYIVKMHDKLMAKKYGFRNPPGLT----YF 1094
            .|        ||:.|    .:|.|.| ::|..:|    ....::|.|::        :|    .|
Human   307 LK--------KEECP----AVRLITL-EEEMTKY----KPESEELTAER--------ITEFCHRF 346

  Fly  1095 RKGKYINYDGDIDDEEEVLDWLTSPANMEMTDHIEQVNRKMFEKIRKNSDYVAVIFYSDECKQCP 1159
            .:||...:   :..:|...||...|..:.:..:.|.|   .|:: :||   |.|.|    ||.||
Human   347 LEGKIKPH---LMSQELPEDWDKQPVKVLVGKNFEDV---AFDE-KKN---VFVEF----CKCCP 397

  Fly  1160  1159
            Human   398  397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)01289NP_001163065.1 PDI_a_family 50..145 CDD:239259
PDI_a_family 384..479 CDD:239259
Thioredoxin_6 510..689 CDD:404691 4/17 (24%)
ER_PDI_fam 700..>916 CDD:273457 63/242 (26%)
PDI_a_family 1129..1226 CDD:239259 12/31 (39%)
TRX_family 1433..>1502 CDD:239245
P4HBXP_024306545.1 YbbN 24..394 CDD:331940 114/499 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.