DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)01289 and CG11790

DIOPT Version :9

Sequence 1:NP_001163065.1 Gene:l(2)01289 / 46017 FlyBaseID:FBgn0010482 Length:1786 Species:Drosophila melanogaster
Sequence 2:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster


Alignment Length:210 Identity:49/210 - (23%)
Similarity:89/210 - (42%) Gaps:48/210 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1423 DRIELITRQMLETMVEETQYLAVYFYKINCNIC-----------DQILEGLELIDDECDVFGIHM 1476
            |..|||      .::..:..:.|.|.|.||..|           .|:.|.|..|          :
  Fly    26 DDTELI------QLLTGSSNVVVLFNKNNCQRCVEYENMVTKIRAQLEETLSAI----------V 74

  Fly  1477 VKIQDPQLAKRYSIKTFPALVYFRNGNPLLFEGDLQNEQSVLEWLIDDDNRELADEIEEVNERML 1541
            |:..|..|...|.....||||:||.|.|:|:.|:: |:..:|::.  :||.|.|  ::|:::...
  Fly    75 VQSVDSNLVSIYDPSKEPALVFFRRGIPILYHGEI-NDDEILDFF--NDNLEPA--VKELSDDNF 134

  Fly  1542 DRLMAESTLLV-----VFFYDDDCAECEEILEELEEIDGE-------ADMFGIDFVKIASIQAAK 1594
            :.|...|:...     :||...:|..|:.:....|.:.|:       |.|..::    :.|..|.
  Fly   135 EHLTQASSGATTGDWFIFFSSAECTVCQRLYAVWESVGGKLKRKLNIARMNSLE----SGISTAT 195

  Fly  1595 KYEIVNIPSLVYFRK 1609
            :..::..|:.::.|:
  Fly   196 RLGVLEAPAFIFLRQ 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)01289NP_001163065.1 PDI_a_family 50..145 CDD:239259
PDI_a_family 384..479 CDD:239259
Thioredoxin_6 510..689 CDD:404691
ER_PDI_fam 700..>916 CDD:273457
PDI_a_family 1129..1226 CDD:239259
TRX_family 1433..>1502 CDD:239245 20/79 (25%)
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 15/88 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19991
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.