DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)01289 and CG14695

DIOPT Version :9

Sequence 1:NP_001163065.1 Gene:l(2)01289 / 46017 FlyBaseID:FBgn0010482 Length:1786 Species:Drosophila melanogaster
Sequence 2:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster


Alignment Length:263 Identity:53/263 - (20%)
Similarity:89/263 - (33%) Gaps:107/263 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 DKHGIQFV-------KIDDAKAAADYGIDSIPAIVYFEKEIPNVYDGDLMDEEQILKWLLGQLER 380
            |.:.|.::       ::|.......:..|. |.:|.|. .:.|.: ||.:|     ||:      
  Fly    10 DNNSIPWILWLPPLTEVDRKSPGGRFTFDG-PKVVAFH-FVKNRH-GDTLD-----KWI------ 60

  Fly   381 DEIEDVTDEMLDTMIKE--GRVIAVLFYDNNDKKSQKVLEELENIDDECDALGITFVKIDNPEEA 443
                    .:||.:.:|  ||   :||          .|.::.||.:        |....||::.
  Fly    61 --------SLLDELAQEYAGR---ILF----------GLRDISNIGE--------FNPNLNPDDF 96

  Fly   444 VEYGINKVPKLIYFEKGI-PTIY----EGNLEDEEKL-----LKWLTDQTSSDQI---------- 488
            ..|           .||: |.||    ||.:.|..||     |:...||..:||:          
  Fly    97 GSY-----------RKGLPPRIYGKDCEGRVYDMHKLVNAKYLREFCDQLLADQLFRAVVLGATA 150

  Fly   489 -------------EDITDEMLDLIIEKMPHVAVLFYDKDQKKSQKILAELENIDDECDQNDIAFV 540
                         |:.:.:||.::.:     ...:|...||:..:.|..|      ....|:..|
  Fly   151 SLDSKPMNYFELREESSSDMLVMLYD-----PACYYWPIQKRMLRKLIRL------LASEDLPIV 204

  Fly   541 KID 543
            .:|
  Fly   205 IVD 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)01289NP_001163065.1 PDI_a_family 50..145 CDD:239259
PDI_a_family 384..479 CDD:239259 25/106 (24%)
Thioredoxin_6 510..689 CDD:404691 8/34 (24%)
ER_PDI_fam 700..>916 CDD:273457
PDI_a_family 1129..1226 CDD:239259
TRX_family 1433..>1502 CDD:239245
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 36/167 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.