DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)01289 and PDIA3

DIOPT Version :9

Sequence 1:NP_001163065.1 Gene:l(2)01289 / 46017 FlyBaseID:FBgn0010482 Length:1786 Species:Drosophila melanogaster
Sequence 2:NP_005304.3 Gene:PDIA3 / 2923 HGNCID:4606 Length:505 Species:Homo sapiens


Alignment Length:560 Identity:107/560 - (19%)
Similarity:200/560 - (35%) Gaps:169/560 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   673 ALYEGDLMNEDEVLEWLLVQKKTAT---IEEVTDEILVTLINEHE----YVVVFFTGPCEPGETC 730
            ||:.|        :..||...:.|.   :.|:||:...:.|::..    .:|.||...|  |. |
Human     7 ALFPG--------VALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWC--GH-C 60

  Fly   731 EHTLNALESIDDELDEAGIIFVT----TEDTGIAKKYNVKTYPRLVFFRNRDPLHFTGDLD---D 788
            :......|:....|  .||:.:.    |.:|....||.|..||.|..||:.:.   .|..|   .
Human    61 KRLAPEYEAAATRL--KGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEE---AGAYDGPRT 120

  Fly   789 EDEVLAWITDDE-TLEIPGKIEEVNVKMLDKILAENDHVVVFFYAEGDKKA-QKILNELENIDDE 851
            .|.:::.:.... ...:|.:.||    ...|.:::.|..:|.|:.:...:| .:.|....|:.| 
Human   121 ADGIVSHLKKQAGPASVPLRTEE----EFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRD- 180

  Fly   852 CEEKDIDFVKTSDDDIDKEYDLPGLPALAF----YRHKF--RTI-YTGDLMKEEEILEWVID--- 906
                :..|..|:.:.:..|||..|...:.|    ..:||  :|: ||...|...:|.:::.:   
Human   181 ----NYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENIF 241

  Fly   907 -----LHESTADVIESVDRKTLQVLINDVEHLAVFFYDDECESCSD---------ILEELENIDD 957
                 :.|...|:|:..|             |.:.:||.:.|..:.         ::...:.:|.
Human   242 GICPHMTEDNKDLIQGKD-------------LLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDA 293

  Fly   958 DTDKHGIQFVKSNDVKLAHEIGIFAFPALVYYETGVPIM-------------------------- 996
            .   |.:.|..::....:||:..|...:..   ..:|::                          
Human   294 G---HKLNFAVASRKTFSHELSDFGLESTA---GEIPVVAIRTAKGEKFVMQEEFSRDGKALERF 352

  Fly   997 ----YDGNI----------ASNQDVFNWILEQKADQSIQLINRDQLFEYIGTKDFLAVVFYKEDD 1047
                :|||:          .||......::.:..|:.:...|:|.|.|           ||    
Human   353 LQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIE-----------FY---- 402

  Fly  1048 PDSPRVLRHIELIDDEAAEYGIYIVKMHDKLMAKKYGFRNPPGLTYFRKGKYINYDGDIDDEEEV 1112
              :| ...|.:.::.:..|.|..:.|..:.::||.....|                 |:....||
Human   403 --AP-WCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATAN-----------------DVPSPYEV 447

  Fly  1113 LDWLT---SPANMEMTDHIEQVNRKMFEKIRKNSDYVAVI 1149
            ..:.|   ||||       :::|.|.:|..|:.||:::.:
Human   448 RGFPTIYFSPAN-------KKLNPKKYEGGRELSDFISYL 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)01289NP_001163065.1 PDI_a_family 50..145 CDD:239259
PDI_a_family 384..479 CDD:239259
Thioredoxin_6 510..689 CDD:404691 3/15 (20%)
ER_PDI_fam 700..>916 CDD:273457 54/243 (22%)
PDI_a_family 1129..1226 CDD:239259 6/21 (29%)
TRX_family 1433..>1502 CDD:239245
PDIA3NP_005304.3 YbbN 25..487 CDD:331940 101/534 (19%)
ER retention motif 502..505
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.