DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hlk and Y73B6BL.12

DIOPT Version :10

Sequence 1:NP_001163065.1 Gene:hlk / 46017 FlyBaseID:FBgn0010482 Length:1786 Species:Drosophila melanogaster
Sequence 2:NP_500961.2 Gene:Y73B6BL.12 / 190648 WormBaseID:WBGene00022236 Length:136 Species:Caenorhabditis elegans


Alignment Length:141 Identity:27/141 - (19%)
Similarity:48/141 - (34%) Gaps:37/141 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   681 NEDEVLEWLLVQKKTATIEEVTDEILVTLINEHEYVVVFFTGPCEPGETCEHTLN---ALESIDD 742
            |.|.:..|:.....|..: .:.::...|:::..|..:|.|..|     .|.|.:.   ..:.|..
 Worm     4 NSDSIQRWVYNFLPTEVV-SLGNDFHTTVLDSSEPWIVDFFAP-----WCGHCIQFAPIYDRIAK 62

  Fly   743 ELDEAGIIFVTTED----TGIAKKYNVKTYPRLVFFRNRDPLHFTGD------------------ 785
            ||  ||.:.....|    .|:.:...|:.||.:..:..:......||                  
 Worm    63 EL--AGKVNFAKIDCDQWPGVCQGAQVRAYPTIRLYTGKTGWSRQGDQGIGIGTQHKEQFIQIVR 125

  Fly   786 ----LDDEDEV 792
                ||:.||:
 Worm   126 QQLKLDEHDEL 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hlkNP_001163065.1 PDI_a_family 50..145 CDD:239259
ER_PDI_fam 381..>670 CDD:273457
PDI_a_family 384..479 CDD:239259
ER_PDI_fam 700..>916 CDD:273457 23/122 (19%)
PDI_a_family 1129..1226 CDD:239259
TRX_family 1433..>1502 CDD:239245
Y73B6BL.12NP_500961.2 PDI_a_ERdj5_C 18..121 CDD:239302 20/110 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.