DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)01289 and D2092.4

DIOPT Version :9

Sequence 1:NP_001163065.1 Gene:l(2)01289 / 46017 FlyBaseID:FBgn0010482 Length:1786 Species:Drosophila melanogaster
Sequence 2:NP_491903.2 Gene:D2092.4 / 172378 WormBaseID:WBGene00017065 Length:363 Species:Caenorhabditis elegans


Alignment Length:323 Identity:80/323 - (24%)
Similarity:134/323 - (41%) Gaps:79/323 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   908 HESTADVIESVDRKTLQVLINDV-EHLAVFFYDDE--CESCSDILEELENIDDDTDKHG-IQFVK 968
            |:...:.|:.||...:..::.|. ::|.:|.||.:  |.:|::.|.|:|.||||.:..| :|.||
 Worm    70 HKDDDNSIDDVDEDRIDEILRDASKNLVIFLYDGKVPCPTCTEALSEVEEIDDDIEATGYVQVVK 134

  Fly   969 SNDVKLAHEIGIFAFPALVYYETGVPIMYDGNIASNQDVFNWILEQKADQSIQLIN-RDQLFEY- 1031
            :||..:|.|:||..||:||||....||:|||:...::.:..|:   :|.:.:...: .|..||. 
 Worm   135 TNDRSVARELGINVFPSLVYYRRKNPILYDGDFKDSETLLRWL---RAHEEVATWDLTDDTFESR 196

  Fly  1032 -------IGTKDFLAVVFYKEDDPDSP------RVLRH----------IEL-IDDEAAEYGIYIV 1072
                   .|:.|:. |:||..|:.:|.      ..:.|          ||: ::|:..|      
 Worm   197 TDSHSPDEGSIDWF-VMFYDADEGNSNAFVPLWETVAHKLRGLVNVGKIEISVNDDVTE------ 254

  Fly  1073 KMHDKLMAKKYGFRNPPGLTYFRKGKYINYDGDIDDEEEVLDWLTSPANMEMTDHIEQVNRKMFE 1137
            :.|.:       .|:.|....|.:||...|.....|..       |..|..:..:.||...::  
 Worm   255 RFHIE-------ERDCPVFLLFHRGKMYRYKESAKDAR-------SLTNFALHKYKEQRGHRV-- 303

  Fly  1138 KIRKNSDYVAVIFYSDECKQCPRVLAEVEHIDDEADKAGIDFVKIDDKQMAKEYGVFALPAIV 1200
                                 |.....:|.:.:.|.:..:|.  :||.|.....||..|..||
 Worm   304 ---------------------PEPPTAIEQVYEFAKEKIMDI--MDDNQTLSVLGVGGLIVIV 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)01289NP_001163065.1 PDI_a_family 50..145 CDD:239259
PDI_a_family 384..479 CDD:239259
Thioredoxin_6 510..689 CDD:404691
ER_PDI_fam 700..>916 CDD:273457 1/7 (14%)
PDI_a_family 1129..1226 CDD:239259 14/72 (19%)
TRX_family 1433..>1502 CDD:239245
D2092.4NP_491903.2 Thioredoxin_like 92..177 CDD:381987 34/84 (40%)
PTZ00443 188..>316 CDD:185622 29/171 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166368
Domainoid 1 1.000 79 1.000 Domainoid score I5609
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19991
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.