DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)01289 and PDIA5

DIOPT Version :9

Sequence 1:NP_001163065.1 Gene:l(2)01289 / 46017 FlyBaseID:FBgn0010482 Length:1786 Species:Drosophila melanogaster
Sequence 2:NP_006801.1 Gene:PDIA5 / 10954 HGNCID:24811 Length:519 Species:Homo sapiens


Alignment Length:504 Identity:107/504 - (21%)
Similarity:190/504 - (37%) Gaps:114/504 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   475 LLKWLTDQTSSDQIEDITD-EMLDLIIEKMPHVAVLFYDKDQKKSQKILAELENIDDEC-DQNDI 537
            |..||:....|..||.|:| :.|..::....:|.|| |.|.:..::..|..|..:.... .|..|
Human    17 LPSWLSSAKVSSLIERISDPKDLKKLLRTRNNVLVL-YSKSEVAAENHLRLLSTVAQAVKGQGTI 80

  Fly   538 AFVKIDD---DKEAKEWGIDEIP--------------------------SIVLF---ERGIPHIY 570
            .:|...|   .|..|:..:|..|                          |||.|   .:| |.::
Human    81 CWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKG-PPLW 144

  Fly   571 EGDLMKEDELLGWLVHQKRYSEIPEVTDEMKD--KLVENTEH-LAVIFYDKDDKQDMRILNELEN 632
            |.|...:|     :||          .|..||  :|::..|. |.::||........|::...:.
Human   145 EEDPGAKD-----VVH----------LDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQK 194

  Fly   633 IDDELEKEGIVI------VRIDNAAEAKEYGLDHLPALIYFE-NKIPALYEGDLMNEDEVLEWLL 690
            ...:|....::.      ...:|..|  ||.:...|.:.||| .:....|:......::::|||.
Human   195 AATQLRGHAVLAGMNVYSSEFENIKE--EYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLK 257

  Fly   691 VQK-------------KTATIEEVTDEILVTLINEHEYVVVFFTGPCEPGETCEHTL-------N 735
            ..:             :..::..:|||.....:.||..|:|.|..|     .|.|..       .
Human   258 NPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMFHAP-----WCGHCKKMKPEFEK 317

  Fly   736 ALESIDDELDEAGIIFV--TTEDTGIAKKYNVKTYPRLVFFRNRD----PLHFTGDLDDEDEVLA 794
            |.|::..|.|.:|::..  .|.:..:|:::::..:|.|.:|:|.:    |:     |..:.:.|.
Human   318 AAEALHGEADSSGVLAAVDATVNKALAERFHISEFPTLKYFKNGEKYAVPV-----LRTKKKFLE 377

  Fly   795 WITDDETLEIPGKI-EEVNVKMLDKI-------LAENDHVVVFFYAEGDKKAQKILNELENIDDE 851
            |:.:.|....|... ||....:|..:       |.:..|.:|.|||......:|::.......|.
Human   378 WMQNPEAPPPPEPTWEEQQTSVLHLVGDNFRETLKKKKHTLVMFYAPWCPHCKKVIPHFTATADA 442

  Fly   852 CEE------KDIDFVKTSDDDIDKEYDLPGLPALAFYRH-KFRTIYTGD 893
            .::      ..:|.||..:.|:.::..:.|.|...:|.: ||...|..|
Human   443 FKDDRKIACAAVDCVKDKNQDLCQQEAVKGYPTFHYYHYGKFAEKYDSD 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)01289NP_001163065.1 PDI_a_family 50..145 CDD:239259
PDI_a_family 384..479 CDD:239259 1/3 (33%)
Thioredoxin_6 510..689 CDD:404691 43/221 (19%)
ER_PDI_fam 700..>916 CDD:273457 50/222 (23%)
PDI_a_family 1129..1226 CDD:239259
TRX_family 1433..>1502 CDD:239245
PDIA5NP_006801.1 PDI_b_PDIR_N 28..139 CDD:239365 24/111 (22%)
PDI_a_PDIR 152..256 CDD:239295 23/120 (19%)
PTZ00102 168..512 CDD:240266 68/336 (20%)
PDI_a_PDIR 277..379 CDD:239295 25/111 (23%)
PDI_a_PDIR 398..501 CDD:239295 20/94 (21%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 516..519
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.