DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tutl and HMCN1

DIOPT Version :10

Sequence 1:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:NP_114141.2 Gene:HMCN1 / 83872 HGNCID:19194 Length:5635 Species:Homo sapiens


Alignment Length:1702 Identity:328/1702 - (19%)
Similarity:590/1702 - (34%) Gaps:489/1702 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LGSHRW----------------------CRALSTQHNTEKSKEQQQ--QSQPLEIPEQRASKCRG 47
            :||||:                      |.| |....|:|.....:  ::..|.:.:.......|
Human   653 VGSHRYRMTSDGTLFIKNAAPKDAGIYGCLA-SNSAGTDKQNSTLRYIEAPKLMVVQSELLVALG 716

  Fly    48 DIDRTTTTTIPASKTLTASPAKTAAFTVKTTRR----------------RRSRRRAEGSSICVPI 96
            ||      |:...||....|.:...|......|                :.::....|...||.|
Human   717 DI------TVMECKTSGIPPPQVKWFKGDLELRPSTFLIIDPLLGLLKIQETQDLDAGDYTCVAI 775

  Fly    97 RRGQGSTPTPTIQVLQ---FVLVSLLALLAKNAQAHNIPEDAVHITAILGEGVIFNCHVEFPNDH 158
            .....:|...|:.|..   |:                  ::...::..:|..|...|:|:   .:
Human   776 NEAGRATGKITLDVGSPPVFI------------------QEPADVSMEIGSNVTLPCYVQ---GY 819

  Fly   159 PVPYVLQWDKKVSETGSDLPIYIWYESYPEHIEEGYKGRVSRVSQDSPFGSASLNLTNIRESDQG 223
            |.| .::|.:.     .::||:               .|...||..|...:.:|.:.|:..||:|
Human   820 PEP-TIKWRRL-----DNMPIF---------------SRPFSVSSISQLRTGALFILNLWASDKG 863

  Fly   224 WYECKVVFLNRDPKQHKNGTWFHLDVHAPPRFSVTPEDIIYVNLGDSIILNCQ-ADGTPTPEILW 287
            .|.|:..  |:..|.....|.....:.| |...::| .:..|..|..:.|.|. ..|.|.||..|
Human   864 TYICEAE--NQFGKIQSETTVTVTGLVA-PLIGISP-SVANVIEGQQLTLPCTLLAGNPIPERRW 924

  Fly   288 YKDANPVDPSPTVGIFNDGTELRISTIRHEDIGEYTCIARNGEGQVSHTARVIIAGGAVIMVPPT 352
            .|::..:..:|.:.:.:||: |.|..::.:|.|||||:|.|..|..:.|..|      |:.|.||
Human   925 IKNSAMLLQNPYITVRSDGS-LHIERVQLQDGGEYTCVASNVAGTNNKTTSV------VVHVLPT 982

  Fly   353 NQ------TKLEGEKVIFSCEAKAMPGNVTVRWYREGSPVREVAALETRVTIRKDGSLIINPIKP 411
            .|      :.:||..|...|:|...| ..:|.|.::|..:...:|   :.:...||||.:.....
Human   983 IQHGQQILSTIEGIPVTLPCKASGNP-KPSVIWSKKGELISTSSA---KFSAGADGSLYVVSPGG 1043

  Fly   412 DDSGQYLCEVTNGIGDPQ---SASAY-----------LSVEYPAKVTFTPTVQYLPFRLAG---V 459
            ::||:|:|..||..|..:   ..:.|           ||.:.|.:::.          |||   .
Human  1044 EESGEYVCTATNTAGYAKRKVQLTVYVRPRVFGDQRGLSQDKPVEISV----------LAGEEVT 1098

  Fly   460 VQCYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVMANGSLLFTRVNEEHQGQYACTPYNAQGTAGA 524
            :.|.:||.|. ..:||.|:.:|:.|:..:. ..:.:||:..|.......|.|.|...|..|....
Human  1099 LPCEVKSLPP-PIITWAKETQLISPFSPRH-TFLPSGSMKITETRTSDSGMYLCVATNIAGNVTQ 1161

  Fly   525 SGVMDVLVRKPPAFTVEPETLYQRKVGDSVEMHCDALEAEGTERPTIKWQRQEGEQLTESQRNRI 589
            :..::|.|  ||.....|:.| :.:||..|::.|:   |:||..|.|.|.:.....|.:.: :.:
Human  1162 AVKLNVHV--PPKIQRGPKHL-KVQVGQRVDIPCN---AQGTPLPVITWSKGGSTMLVDGE-HHV 1219

  Fly   590 KISGGNITIENLRREDFGYYQCVVSNEVATLMAVTQLVIEGTQP------HAPYNITGKATESSI 648
            ....|.::|:.....|.|.|.||.:|...|  ..|::.:...:|      ..|||.|        
Human  1220 SNPDGTLSIDQATPSDAGIYTCVATNIAGT--DETEITLHVQEPPTVEDLEPPYNTT-------- 1274

  Fly   649 TLQWLPGYSGGSEYKQDYTIWFREAGVNDWQTISVTPSGSTQVTINGLASGTTYEFQVVGRNVLG 713
                                 |:|...|..........|:.:.||..|.:|.....:..|.::|.
Human  1275 ---------------------FQERVANQRIEFPCPAKGTPKPTIKWLHNGRELTGREPGISILE 1318

  Fly   714 DGMMSKVMTVRTLEDAPAAPRNVKAATQPPDSFFQLMPDEADLLAYFDIYFHTDSRGTL-VYSPP 777
            ||.:..:.:|...::.               .:..:..:||..         |:.:..| |:.||
Human  1319 DGTLLVIASVTPYDNG---------------EYICVAVNEAGT---------TERKYNLKVHVPP 1359

  Fly   778 KLRVKGPKPGPPRNVSV--TEVSNGFLITWQSPLERAHIVKFY--TIKYRTDAQWKTLNRGQI-- 836
            .::.|    ....||||  .:::|.|.....:|   :.|:.:|  .::....:..:|:|.|:|  
Human  1360 VIKDK----EQVTNVSVLLNQLTNLFCEVEGTP---SPIIMWYKDNVQVTESSTIQTVNNGKILK 1417

  Fly   837 ----RPEET-QYLVK--NLVGGRTYYFRVLANSEKSYESSDEVKFPVPARVKHKAITAGVVGGIL 894
                .||:. :|..|  |:.|....||.:            :|..| |.          ::|...
Human  1418 LFRATPEDAGRYSCKAINIAGTSQKYFNI------------DVLVP-PT----------IIGTNF 1459

  Fly   895 FFIVAIILS-----VCAVK------------------------------ICNKRKRRKQEKEFNM 924
            ...|:::|:     .|.||                              :.:.:..|:.:|  ..
Human  1460 PNEVSVVLNRDVALECQVKGTPFPDIHWFKDGKPLFLGDPNVELLDRGQVLHLKNARRNDK--GR 1522

  Fly   925 VACRITDARNIAANNHHLHNRSTGSISSGQVP----------LKKYKQTRISSLTAILIAILHWI 979
            ..|.:::|....|.:..|......||..|.|.          :|...:||...:.||       .
Human  1523 YQCTVSNAAGKQAKDIKLTIYIPPSIKGGNVTTDISVLINSLIKLECETRGLPMPAI-------T 1580

  Fly   980 WPPDRCTNCHSIYSSPNLEDGDEDDGGGGRRRSVSRIQRSLDGRFVLDVEGVSKLGYSQQTLESG 1044
            |..|.    ..|.||......|:     |:...:.|.|.|....:...|..|:  |.::   :|.
Human  1581 WYKDG----QPIMSSSQALYIDK-----GQYLHIPRAQVSDSATYTCHVANVA--GTAE---KSF 1631

  Fly  1045 NVDV-----VDGGLFERRNSNV--------SQKSSSDDGGFLS-RRNFITARASWRRPLVASSSQ 1095
            :|||     ::|.|....|..|        ..|::.:....|: .::.:..:|:....:.|...:
Human  1632 HVDVYVPPMIEGNLATPLNKQVVIAHSLTLECKAAGNPSPILTWLKDGVPVKANDNIRIEAGGKK 1696

  Fly  1096 LSLQSAADSARG-FLQGLLKIGAKQS-------AVPP-----NSQSYF----------DEAVSGA 1137
            |.:.||.:..|| ::.....:..::.       .|||     :..|||          |..|:|:
Human  1697 LEIMSAQEIDRGQYICVATSVAGEKEIKYEVDVLVPPAIEGGDETSYFIVMVNNLLELDCHVTGS 1761

  Fly  1138 --------------------------RYQNVLRPYTSSNNLYGNADRSRPLHINTISGSLSQ-QQ 1175
                                      |...:.:...|:..||      |.:..||......: :.
Human  1762 PPPTIMWLKDGQLIDERDGFKILLNGRKLVIAQAQVSNTGLY------RCMAANTAGDHKKEFEV 1820

  Fly  1176 QLYTPSRISRIFSSSPQQLQPHHQQLLLSSGGSGAYPTHFSDLSTVYPPNSAERSSHNLSSRYRY 1240
            .::.|..|..  |...:::...::.:.|....:|......:.|....|.|:|:.:....||    
Human  1821 TVHVPPTIKS--SGLSERVVVKYKPVALQCIANGIPNPSITWLKDDQPVNTAQGNLKIQSS---- 1879

  Fly  1241 YSQELPSLRTIQEE--------TRRQQQQKQHPLEDHFVPLQLPSPPSWRS-------------- 1283
             .:.|...:|:.|:        |....:.:||      :.|.:..|||...              
Human  1880 -GRVLQIAKTLLEDAGRYTCVATNAAGETQQH------IQLHVHEPPSLEDAGKMLNETVLVSNP 1937

  Fly  1284 -YYQSQASYR--PRTRWYPRHHSRLFSNRQQQHEMLSPLPQLNLNLRNSMNPGGLEASPESRSSS 1345
             ..:.:|:..  |...||            :.:.:||....:..     :|.|.:.....::.|.
Human  1938 VQLECKAAGNPVPVITWY------------KDNRLLSGSTSMTF-----LNRGQIIDIESAQISD 1985

  Fly  1346 SGFGSKNTSNHPGSTSEWRLLPPYRAPPSPPKHSGYFGGQ----------------QAQGQTPHG 1394
            :|.......|..|:|..:..|..:.||.        ..|.                :|:| .|..
Human  1986 AGIYKCVAINSAGATELFYSLQVHVAPS--------ISGSNNMVAVVVNNPVRLECEARG-IPAP 2041

  Fly  1395 SYSYPRATTPPYTMAHWLEMIS--RLNAATDSNLPKAPCPVDVGSVDGHYEFDPATPTPSASSML 1457
            |.::.:..:|..:.::.|:::|  |:.|.|.:.:          |..|.|    .....:|:...
Human  2042 SLTWLKDGSPVSSFSNGLQVLSGGRILALTSAQI----------SDTGRY----TCVAVNAAGEK 2092

  Fly  1458 REDLNLHIDTHP 1469
            :.|::|.:...|
Human  2093 QRDIDLRVYVPP 2104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 138..250 CDD:462230 23/111 (21%)
I-set 253..341 CDD:400151 28/88 (32%)
Ig strand B 271..275 CDD:409353 1/3 (33%)
Ig strand C 284..288 CDD:409353 1/3 (33%)
Ig strand E 308..311 CDD:409353 1/2 (50%)
Ig strand F 321..326 CDD:409353 4/4 (100%)
Ig strand G 334..337 CDD:409353 0/2 (0%)
Ig 346..437 CDD:472250 28/110 (25%)
Ig strand B 362..366 CDD:409353 1/3 (33%)
Ig strand C 376..380 CDD:409353 1/3 (33%)
Ig strand E 402..406 CDD:409353 3/3 (100%)
Ig strand F 416..421 CDD:409353 2/4 (50%)
Ig strand G 430..433 CDD:409353 0/2 (0%)
Ig <459..530 CDD:472250 17/70 (24%)
Ig strand B 459..462 CDD:409353 0/2 (0%)
Ig strand C 471..476 CDD:409353 1/4 (25%)
Ig strand E 496..500 CDD:409353 2/3 (67%)
Ig strand F 510..515 CDD:409353 2/4 (50%)
Ig strand G 523..526 CDD:409353 0/2 (0%)
Ig_3 535..615 CDD:464046 22/79 (28%)
FN3 633..725 CDD:238020 18/97 (19%)
FN3 786..874 CDD:238020 22/100 (22%)
HMCN1NP_114141.2 ChlD <12..210 CDD:440853
Ig 448..513 CDD:409353
Ig strand B 448..451 CDD:409353
Ig strand C 460..464 CDD:409353
Ig strand E 482..486 CDD:409353
Ig strand F 496..501 CDD:409353
Ig strand G 510..513 CDD:409353
IG_like 526..608 CDD:214653
Ig strand B 537..541 CDD:409353
Ig strand C 550..554 CDD:409353
Ig strand E 574..578 CDD:409353
Ig strand F 588..593 CDD:409353
Ig strand G 601..604 CDD:409353
I-set 612..696 CDD:400151 9/43 (21%)
Ig strand B 629..633 CDD:409353
Ig strand C 642..646 CDD:409353
Ig strand E 664..668 CDD:409353 0/3 (0%)
Ig strand F 678..683 CDD:409353 1/4 (25%)
Ig strand G 691..694 CDD:409353 1/2 (50%)
Ig 713..789 CDD:472250 15/81 (19%)
Ig strand B 720..723 CDD:409353 0/2 (0%)
Ig strand C 732..736 CDD:409353 0/3 (0%)
Ig strand E 755..759 CDD:409353 0/3 (0%)
Ig strand F 769..774 CDD:409353 1/4 (25%)
Ig strand G 783..786 CDD:409353 0/2 (0%)
Ig 793..884 CDD:472250 24/134 (18%)
Ig strand B 810..814 CDD:409353 1/3 (33%)
Ig strand C 823..829 CDD:409353 1/5 (20%)
Ig strand E 850..854 CDD:409353 1/3 (33%)
Ig strand F 864..869 CDD:409353 2/4 (50%)
Ig strand G 877..880 CDD:409353 0/2 (0%)
Ig 890..977 CDD:472250 28/94 (30%)
Ig strand B 907..911 CDD:409353 1/3 (33%)
Ig strand C 921..925 CDD:409353 1/3 (33%)
Ig strand E 943..947 CDD:409353 2/4 (50%)
Ig strand F 957..962 CDD:409353 4/4 (100%)
Ig 980..1071 CDD:472250 25/94 (27%)
Ig strand B 998..1002 CDD:409353 1/3 (33%)
Ig strand C 1011..1015 CDD:409353 1/3 (33%)
Ig strand E 1035..1038 CDD:409353 2/2 (100%)
Ig strand F 1048..1053 CDD:409353 2/4 (50%)
Ig strand G 1061..1064 CDD:409353 0/2 (0%)
IG_like 1086..1167 CDD:214653 21/92 (23%)
Ig strand B 1097..1101 CDD:409353 0/3 (0%)
Ig strand C 1110..1114 CDD:409353 1/3 (33%)
Ig strand E 1134..1137 CDD:409353 1/2 (50%)
Ig strand F 1147..1152 CDD:409353 2/4 (50%)
Ig strand G 1160..1163 CDD:409353 0/2 (0%)
I-set 1171..1258 CDD:400151 24/93 (26%)
Ig strand B 1188..1192 CDD:409353 1/3 (33%)
Ig strand C 1201..1205 CDD:409353 1/3 (33%)
Ig strand E 1224..1228 CDD:409353 1/3 (33%)
Ig strand F 1238..1243 CDD:409353 2/4 (50%)
Ig strand G 1251..1254 CDD:409353 1/2 (50%)
Ig 1262..1355 CDD:472250 21/145 (14%)
Ig strand B 1284..1288 CDD:409353 0/3 (0%)
Ig strand C 1297..1301 CDD:409353 2/3 (67%)
Ig strand E 1320..1324 CDD:409353 1/3 (33%)
Ig strand F 1335..1340 CDD:409353 0/4 (0%)
Ig strand G 1348..1351 CDD:409353 0/2 (0%)
Ig 1369..1442 CDD:472250 19/75 (25%)
Ig strand C 1391..1395 CDD:409353 1/3 (33%)
Ig strand E 1414..1418 CDD:409353 1/3 (33%)
Ig strand F 1428..1433 CDD:409353 1/4 (25%)
Ig strand G 1441..1444 CDD:409353 0/2 (0%)
Ig_3 1451..1529 CDD:464046 11/90 (12%)
I-set 1556..1635 CDD:400151 20/99 (20%)
Ig strand B 1565..1569 CDD:409353 1/3 (33%)
Ig strand C 1578..1582 CDD:409353 2/10 (20%)
Ig strand E 1601..1605 CDD:409353 0/3 (0%)
Ig strand F 1615..1620 CDD:409353 0/4 (0%)
Ig strand G 1628..1631 CDD:409353 0/5 (0%)
Ig 1648..1725 CDD:472250 11/76 (14%)
Ig strand B 1659..1663 CDD:409353 0/3 (0%)
Ig strand C 1672..1676 CDD:409353 1/3 (33%)
Ig strand E 1695..1699 CDD:409353 1/3 (33%)
Ig strand F 1709..1714 CDD:409353 0/4 (0%)
Ig 1746..1822 CDD:472250 10/81 (12%)
Ig strand B 1752..1756 CDD:409353 0/3 (0%)
Ig strand C 1765..1769 CDD:409353 0/3 (0%)
Ig strand E 1788..1792 CDD:409353 1/3 (33%)
Ig strand F 1802..1807 CDD:409353 3/10 (30%)
Ig 1828..1905 CDD:472250 14/83 (17%)
Ig strand B 1844..1848 CDD:409353 1/3 (33%)
Ig strand C 1857..1861 CDD:409353 0/3 (0%)
Ig strand E 1881..1885 CDD:409353 1/3 (33%)
Ig strand F 1895..1900 CDD:409353 0/4 (0%)
Ig 1928..2000 CDD:472250 12/88 (14%)
Ig strand B 1938..1942 CDD:409353 0/3 (0%)
Ig strand C 1951..1955 CDD:409353 0/3 (0%)
Ig strand E 1973..1978 CDD:409353 1/4 (25%)
Ig strand F 1988..1993 CDD:409353 0/4 (0%)
Ig 2031..2092 CDD:472250 14/75 (19%)
Ig strand C 2042..2046 CDD:409353 1/3 (33%)
Ig strand E 2065..2070 CDD:409353 1/4 (25%)
Ig strand F 2080..2085 CDD:409353 1/8 (13%)
Ig_3 2103..2178 CDD:464046 1/2 (50%)
Ig 2203..2286 CDD:472250
Ig strand C 2227..2231 CDD:409353
Ig strand E 2251..2256 CDD:409353
Ig strand F 2266..2271 CDD:409353
Ig_3 2289..2367 CDD:464046
I-set 2391..2474 CDD:400151
Ig strand B 2404..2408 CDD:409353
Ig strand C 2417..2421 CDD:409353
Ig strand E 2440..2444 CDD:409353
Ig strand F 2454..2459 CDD:409353
I-set 2478..2567 CDD:400151
Ig strand B 2497..2501 CDD:409353
Ig strand C 2510..2514 CDD:409353
Ig strand E 2533..2537 CDD:409353
Ig strand F 2547..2552 CDD:409353
I-set 2582..2663 CDD:400151
Ig strand B 2593..2597 CDD:409353
Ig strand C 2606..2610 CDD:409353
Ig strand E 2629..2633 CDD:409353
Ig strand F 2643..2648 CDD:409353
Ig strand G 2656..2659 CDD:409353
I-set 2681..2762 CDD:400151
Ig strand B 2692..2696 CDD:409353
Ig strand C 2705..2709 CDD:409353
Ig strand E 2727..2732 CDD:409353
Ig strand F 2742..2747 CDD:409353
I-set 2789..2858 CDD:400151
Ig strand B 2795..2799 CDD:409353
Ig strand C 2808..2812 CDD:409353
Ig strand E 2831..2835 CDD:409353
Ig strand F 2845..2850 CDD:409353
I-set 2879..2960 CDD:400151
Ig strand B 2890..2894 CDD:409353
Ig strand C 2903..2907 CDD:409353
Ig strand E 2926..2930 CDD:409353
Ig strand F 2940..2945 CDD:409353
I-set 2970..3052 CDD:400151
Ig strand B 2982..2986 CDD:409353
Ig strand C 2995..2999 CDD:409353
Ig strand E 3018..3022 CDD:409353
Ig strand F 3032..3037 CDD:409353
Ig strand G 3045..3048 CDD:409353
I-set 3066..3147 CDD:400151
Ig strand B 3077..3081 CDD:409353
Ig strand C 3090..3094 CDD:409353
Ig strand E 3111..3117 CDD:409353
Ig strand F 3127..3132 CDD:409353
Ig strand G 3140..3143 CDD:409353
Ig_3 3150..3228 CDD:464046
I-set 3252..3336 CDD:400151
Ig strand B 3264..3268 CDD:409353
Ig strand C 3277..3281 CDD:409353
Ig strand E 3302..3306 CDD:409353
Ig strand F 3316..3321 CDD:409353
Ig strand G 3329..3332 CDD:409353
I-set 3356..3430 CDD:400151
Ig strand B 3360..3364 CDD:409353
Ig strand C 3373..3377 CDD:409353
Ig strand E 3396..3400 CDD:409353
Ig strand F 3410..3415 CDD:409353
Ig strand G 3423..3426 CDD:409353
I-set 3445..3523 CDD:400151
Ig strand B 3453..3457 CDD:409353
Ig strand C 3466..3470 CDD:409353
Ig strand E 3488..3493 CDD:409353
Ig strand F 3503..3508 CDD:409353
Ig strand G 3516..3519 CDD:409353
Ig_3 3526..3602 CDD:464046
I-set 3628..3709 CDD:400151
Ig strand B 3639..3643 CDD:409353
Ig strand C 3652..3656 CDD:409353
Ig strand E 3674..3679 CDD:409353
Ig strand F 3689..3694 CDD:409353
Ig strand G 3702..3705 CDD:409353
Ig 3715..3791 CDD:472250
Ig strand B 3730..3734 CDD:409353
Ig strand C 3743..3747 CDD:409353
Ig strand E 3766..3770 CDD:409353
Ig strand F 3780..3785 CDD:409353
Ig_3 3803..3880 CDD:464046
Ig 3899..3984 CDD:472250
Ig strand B 3914..3918 CDD:409353
Ig strand C 3927..3931 CDD:409353
Ig strand E 3950..3954 CDD:409353
Ig strand F 3964..3969 CDD:409353
Ig strand G 3977..3980 CDD:409353
Ig_3 3987..4062 CDD:464046
I-set 4079..4165 CDD:400151
Ig strand B 4096..4100 CDD:409353
Ig strand C 4109..4113 CDD:409353
Ig strand E 4131..4135 CDD:409353
Ig strand F 4145..4150 CDD:409353
Ig strand G 4158..4161 CDD:409353
Ig_3 4168..4243 CDD:464046
I-set 4260..4345 CDD:400151
Ig strand B 4277..4281 CDD:409353
Ig strand C 4290..4294 CDD:409353
Ig strand E 4311..4315 CDD:409353
Ig strand F 4325..4330 CDD:409353
Ig 4364..4435 CDD:472250
Ig strand B 4367..4371 CDD:409353
Ig strand C 4380..4384 CDD:409353
Ig strand E 4402..4406 CDD:409353
Ig strand F 4416..4421 CDD:409353
Ig strand G 4429..4432 CDD:409353
Ig 4441..4526 CDD:472250
Ig strand B 4457..4461 CDD:409353
Ig strand C 4470..4474 CDD:409353
Ig strand E 4492..4496 CDD:409353
Ig strand F 4506..4511 CDD:409353
Ig strand G 4519..4522 CDD:409353
TSP1 4533..4584 CDD:214559
TSP1 4589..4641 CDD:214559
TSP1 4646..4698 CDD:214559
TSP1 4703..4755 CDD:214559
TSP1 4760..4812 CDD:214559
TSP1 4817..4869 CDD:214559
G2F 4868..5092 CDD:214774
EGF_CA 5107..5146 CDD:214542
EGF_CA 5147..5180 CDD:429571
EGF_CA 5192..5228 CDD:214542
EGF_CA 5230..5263 CDD:238011
EGF_CA 5272..5303 CDD:429571
EGF_CA 5315..5354 CDD:214542
EGF_CA 5432..5471 CDD:214542
EGF_CA 5472..5508 CDD:214542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.