DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tutl and igsf21b

DIOPT Version :10

Sequence 1:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:NP_001103943.1 Gene:igsf21b / 567714 ZFINID:ZDB-GENE-070424-59 Length:473 Species:Danio rerio


Alignment Length:465 Identity:97/465 - (20%)
Similarity:164/465 - (35%) Gaps:146/465 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 SVTPEDIIYVNLGDSIILNC--QADGTPTPEILWYKDANPVDPSPTV----GIFNDG-------- 306
            :||.|.:..|.:||::.|.|  :.||. ..||:|::..........:    .::|..        
Zfish    23 TVTIEPLPPVVMGDTVTLKCNFRTDGN-LREIVWFRVTEGGTSKQKIFTYDAMYNTNFSHMEDFR 86

  Fly   307 --------TELRISTIRHEDIGEYTCIARNGEGQVSHTARVIIAGGAV---IMVPPTNQTKLEGE 360
                    :.:|:..::.||.|.|.|  ..|....:...:|::|.|::   :|.||         
Zfish    87 RREDLVYQSTVRLPEVQMEDDGPYEC--HVGIYDRASREKVVLASGSITLNVMSPP--------- 140

  Fly   361 KVIFSCEAKAMPG--------NVTVRWYREG---SPVREVAALETRVTIRKDGSLI-INPIKPDD 413
            |.|| .||...|.        |.|:.....|   :||         |..::||.:| ::|....:
Zfish   141 KSIF-VEAANQPARFNRYEAQNFTLVCIVTGGKPAPV---------VYFKRDGEVIEVHPFASSE 195

  Fly   414 SGQYLCEVTN-GIGDPQSASAYLSVEY-PAKVTFTPTVQYL-----PFRLAGVVQCYIKSSPQLQ 471
                  :|.| |:..|:.....:|.|. ..||  ..::.::     |.||.       |..||..
Zfish   196 ------KVENRGLLAPKDNQPLISRELDDTKV--QKSLSFMGPYSEPVRLD-------KDRPQRS 245

  Fly   472 YVTWTKDKRLLEPYQMKDIV------------VMANGSLLF--TRVNEEHQGQ------------ 510
            |.:......  ||....:::            |:::..|.|  ...:|.|.|.            
Zfish   246 YTSGAPTHE--EPSPTTEVIPETVISREFPRWVLSSSPLYFFNQTQSELHDGTLEVQAMLTWHLN 308

  Fly   511 --------YAC--------TPYNAQGTAGASGVMDVLVRKPPAFTVEPETLYQRKVGDSVEMHCD 559
                    ::|        .|..|:.|..|.        |.|..:|.|.   :.||||:|.:..:
Zfish   309 PQLDNEALFSCEVKHPALSMPMKAEVTLSAP--------KGPKLSVAPS---RAKVGDTVRIKVE 362

  Fly   560 ALEA-----EGTERPTIKWQRQEGEQLTESQRNRIKISGGNITIENLRREDFG-YYQCVVSNEVA 618
            ..:.     |....|...|.|..|..|..|:..    .|..:.:|.:..|..| .|:|.|.|.:.
Zfish   363 GFQMGPKANEVFPEPLFTWTRVGGPLLDGSEER----FGKELVLERVPAELNGSMYRCTVQNPLG 423

  Fly   619 TLMAVTQLVI 628
            :....|:|::
Zfish   424 STNTHTRLIV 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 138..250 CDD:462230
I-set 253..341 CDD:400151 22/106 (21%)
Ig strand B 271..275 CDD:409353 1/3 (33%)
Ig strand C 284..288 CDD:409353 2/3 (67%)
Ig strand E 308..311 CDD:409353 0/2 (0%)
Ig strand F 321..326 CDD:409353 2/4 (50%)
Ig strand G 334..337 CDD:409353 0/2 (0%)
Ig 346..437 CDD:472250 23/106 (22%)
Ig strand B 362..366 CDD:409353 2/3 (67%)
Ig strand C 376..380 CDD:409353 1/3 (33%)
Ig strand E 402..406 CDD:409353 2/4 (50%)
Ig strand F 416..421 CDD:409353 0/4 (0%)
Ig strand G 430..433 CDD:409353 0/2 (0%)
Ig <459..530 CDD:472250 17/112 (15%)
Ig strand B 459..462 CDD:409353 0/2 (0%)
Ig strand C 471..476 CDD:409353 1/4 (25%)
Ig strand E 496..500 CDD:409353 1/3 (33%)
Ig strand F 510..515 CDD:409353 1/32 (3%)
Ig strand G 523..526 CDD:409353 1/2 (50%)
Ig_3 535..615 CDD:464046 22/85 (26%)
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
igsf21bNP_001103943.1 Ig 24..125 CDD:472250 21/103 (20%)
Ig strand B 38..42 CDD:409353 1/3 (33%)
Ig strand C 52..56 CDD:409353 2/3 (67%)
Ig strand E 95..99 CDD:409353 0/3 (0%)
Ig strand F 109..114 CDD:409353 2/6 (33%)
Ig <375..435 CDD:472250 16/63 (25%)
Ig strand C 378..382 CDD:409353 0/3 (0%)
Ig strand E 398..402 CDD:409353 0/3 (0%)
Ig strand F 412..418 CDD:409353 2/5 (40%)
Ig strand G 427..430 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.