DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tutl and dpr5

DIOPT Version :9

Sequence 1:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:285 Identity:62/285 - (21%)
Similarity:104/285 - (36%) Gaps:74/285 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 LLAKNAQAHNIPE--DAV----------HITAILGEGVIFNCHVEFPNDHPVPYVLQWDKKVSET 173
            |.|....::.||:  ||:          .:.|.||.....:|.|....|..|.::.|.|..:...
  Fly    71 LAAAEELSNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTI 135

  Fly   174 GSDLPIYIWYESY-PEHIEEGYKGRVSRVSQDSPFGSASLNLTNIRESDQGWYECKVVFLNRDPK 237
            |  :..|...:.: ..||:..              ....|.:.::::.|.|.|||:|   :.:||
  Fly   136 G--IMTYTNDQRFLARHIDNS--------------DEWVLKIVSVQQRDAGVYECQV---STEPK 181

  Fly   238 ---QHKNGTWFHLDVHAPPRFSVTPEDIIYVNLGDSIILNCQADGTPTP--EILWYKDANPVDPS 297
               .:|.       |....:..:.....:::..|..|.|.|.|...|.|  .:||:||...|..|
  Fly   182 ISLAYKL-------VVVTSKAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLWHKDTELVSDS 239

  Fly   298 PTVGIFNDG------TELRISTIRHEDIGEYTCIARNGEG---------QVSHTAR--------- 338
            ...||..:.      :.|.||.::|.|.|.|||.|.|...         ...|.|.         
  Fly   240 ARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNSNSDSVFVHIIKSEQHAAMQHELGSRLL 304

  Fly   339 ------VIIAGGAVIMVPPTNQTKL 357
                  :::|...|:::.||:..::
  Fly   305 LPPLPLLLLAVLLVVLLGPTSSLQI 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 23/116 (20%)
IG_like 137..229 CDD:214653 19/92 (21%)
I-set 253..341 CDD:254352 28/119 (24%)
IGc2 268..331 CDD:197706 26/70 (37%)
I-set 346..437 CDD:254352 3/12 (25%)
Ig 349..437 CDD:299845 2/9 (22%)
Ig 459..530 CDD:299845
IG_like 549..628 CDD:214653
IGc2 551..617 CDD:197706
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
dpr5NP_650080.3 V-set 95..191 CDD:284989 24/121 (20%)
IG_like 98..179 CDD:214653 20/99 (20%)
IG_like 206..278 CDD:214653 26/71 (37%)
Ig 211..278 CDD:143165 25/66 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.