DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tutl and IGLON5

DIOPT Version :9

Sequence 1:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:NP_001094842.1 Gene:IGLON5 / 402665 HGNCID:34550 Length:336 Species:Homo sapiens


Alignment Length:345 Identity:85/345 - (24%)
Similarity:136/345 - (39%) Gaps:57/345 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 PTPTIQVLQFVLVSLLALLAKNAQAH----NIPEDAVHITAILGEGVIFNCHVEFPNDHPVPYVL 164
            |...:::|....::.||::::...:.    |.|.|  :.|...|:....:|   |.::|......
Human     6 PGARLRLLAAAALAGLAVISRGLLSQSLEFNSPAD--NYTVCEGDNATLSC---FIDEHVTRVAW 65

  Fly   165 QWDKKVSETGSDLPIYIWYESYPEHIEEGYKGRVSRVSQDSPFGSASLNLTNIRESDQGWYECKV 229
            .....:...|:|.     :.|.|         || |:..::| ...|:.:|.:...|:|.|.|..
Human    66 LNRSNILYAGNDR-----WTSDP---------RV-RLLINTP-EEFSILITEVGLGDEGLYTCSF 114

  Fly   230 VFLNRDPKQHKNGTWFHLDVHAPPRFSVTPEDIIYVNLGDSIILNCQADGTPTPEILW--YKDAN 292
                 ..:.....|..:|.||.|.|. |.....:.||.|.::.|.|.|.|.|.|.:.|  .:|  
Human   115 -----QTRHQPYTTQVYLIVHVPARI-VNISSPVTVNEGGNVNLLCLAVGRPEPTVTWRQLRD-- 171

  Fly   293 PVDPSPTVGIFNDGTELRISTIRHEDIGEYTCIARNGEGQVSHTARVIIAGGAVIMVPPT----- 352
                    |..::|..|.||.|:....|||.|:..||......:.||::    .:..|||     
Human   172 --------GFTSEGEILEISDIQRGQAGEYECVTHNGVNSAPDSRRVLV----TVNYPPTITDVT 224

  Fly   353 -NQTKLEGEKVIFSCEAKAMPGNVTVRWYREGSPVREVAALETRV-TIRKDGSLIINPIKPDDSG 415
             .:|.| |...:..|||.|:| ....:||::...:....|...:| |.|....|:...:.....|
Human   225 SARTAL-GRAALLRCEAMAVP-PADFQWYKDDRLLSSGTAEGLKVQTERTRSMLLFANVSARHYG 287

  Fly   416 QYLCEVTNGIGDPQSASAYL 435
            .|.|...|.:| ..|||..|
Human   288 NYTCRAANRLG-ASSASMRL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 21/112 (19%)
IG_like 137..229 CDD:214653 19/91 (21%)
I-set 253..341 CDD:254352 27/89 (30%)
IGc2 268..331 CDD:197706 21/64 (33%)
I-set 346..437 CDD:254352 27/97 (28%)
Ig 349..437 CDD:299845 27/94 (29%)
Ig 459..530 CDD:299845
IG_like 549..628 CDD:214653
IGc2 551..617 CDD:197706
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
IGLON5NP_001094842.1 Ig 41..129 CDD:416386 21/111 (19%)
Ig strand A' 41..46 CDD:409353 1/4 (25%)
Ig strand B 48..56 CDD:409353 1/10 (10%)
CDR1 56..60 CDD:409353 0/3 (0%)
FR2 61..68 CDD:409353 0/6 (0%)
Ig strand C 61..67 CDD:409353 0/5 (0%)
CDR2 69..79 CDD:409353 2/14 (14%)
Ig strand C' 71..74 CDD:409353 0/2 (0%)
Ig strand C' 76..79 CDD:409353 1/7 (14%)
FR3 80..115 CDD:409353 12/50 (24%)
Ig strand D 84..91 CDD:409353 3/7 (43%)
Ig strand E 94..100 CDD:409353 1/5 (20%)
Ig strand F 107..115 CDD:409353 3/12 (25%)
CDR3 116..120 CDD:409353 0/3 (0%)
Ig strand G 120..129 CDD:409353 2/8 (25%)
FR4 122..129 CDD:409353 2/6 (33%)
Ig_3 134..199 CDD:404760 23/75 (31%)
Ig strand B 148..157 CDD:409353 2/8 (25%)
Ig strand C 162..170 CDD:409353 2/7 (29%)
Ig strand F 191..199 CDD:409353 4/7 (57%)
Ig strand G 202..212 CDD:409353 2/9 (22%)
Ig_3 217..295 CDD:404760 21/79 (27%)
putative Ig strand A 218..224 CDD:409353 2/5 (40%)
Ig strand B 234..238 CDD:409353 0/3 (0%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 1/3 (33%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
Ig strand G 301..304 CDD:409353 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.