DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tutl and dpr10

DIOPT Version :9

Sequence 1:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:367 Identity:79/367 - (21%)
Similarity:125/367 - (34%) Gaps:128/367 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 PTNQTKLEGEKVIFSCEAKAMPGNVTVRWYREGSPVREVAALETRVTIRKDGSLIINPIKPDDSG 415
            |.|.|.|.|:.....|..|.: ||.||.|.|.    |::..|..                    |
  Fly    60 PRNITSLVGKSAYLGCRVKHL-GNKTVAWIRH----RDLHILTV--------------------G 99

  Fly   416 QYLCEVTNGIGDPQSASAYLSVEYPAKVTFTPTVQYLPFRLAGVVQCYIKSSPQLQYV------- 473
            .|    |.........|.:..::     .:|..:::...|.|||.:|.|.:.|...|.       
  Fly   100 TY----TYTTDQRFQTSYHRDID-----EWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVD 155

  Fly   474 ---TWTKDKRLLEPYQMKDIVVMANGSLLFTRVNEEHQGQYACTPYNAQGTAGASGVMDVLVRKP 535
               ..|.|  :::.|...|...:|. :.::...|:|..|.:......|..||...|..|:.|.| 
  Fly   156 LIDAETSD--IMQQYYNDDAFYIAE-NRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDK- 216

  Fly   536 PAFTVEPETLYQRKVGDSVEMHCDALEAEGTERPT-IKWQRQEGEQLTESQRNRIKISGGNITIE 599
                           |.::.:.|  :.....|.|| |.|..|: :.|:|      :.|||.:..:
  Fly   217 ---------------GSTINLTC--IIKFSPEPPTHIFWYHQD-KVLSE------ETSGGRLKFK 257

  Fly   600 NLRRED--------------FGYYQCVVSN-EVATLMAVTQLVIEGTQPH------APYNIT--- 640
            .::.|:              .|.|.|..|| |:|::..   .|::|.:|.      ||..:.   
  Fly   258 TIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRV---HVLQGERPEAMQTNAAPAAVALAC 319

  Fly   641 -----GKATE------------------SSITLQWLPGYSGG 659
                 |:||:                  ||:.||     |||
  Fly   320 WSCHFGQATQAVRVISTMVAALVLLEACSSLLLQ-----SGG 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989
IG_like 137..229 CDD:214653
I-set 253..341 CDD:254352
IGc2 268..331 CDD:197706
I-set 346..437 CDD:254352 19/85 (22%)
Ig 349..437 CDD:299845 19/85 (22%)
Ig 459..530 CDD:299845 17/80 (21%)
IG_like 549..628 CDD:214653 21/94 (22%)
IGc2 551..617 CDD:197706 19/81 (23%)
FN3 633..725 CDD:238020 13/59 (22%)
FN3 786..874 CDD:238020
dpr10NP_729591.1 Ig 63..143 CDD:299845 24/113 (21%)
IG_like 210..297 CDD:214653 24/114 (21%)
IGc2 217..287 CDD:197706 17/78 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.