DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tutl and dpr20

DIOPT Version :9

Sequence 1:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:406 Identity:82/406 - (20%)
Similarity:146/406 - (35%) Gaps:113/406 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ALSTQHNTEKSKEQQQQS--------QPLEIPEQRASKCRGDIDR---------------TTTTT 56
            |:..|.::.|.::.:..|        .|...|:....|......:               ||::.
  Fly   131 AILDQDSSMKGQDMESLSLQAGSGTVSPKSSPDSSGHKKNASFQQIGSQNVNALVPATVATTSSG 195

  Fly    57 IPASKTLT-ASPAKTAAFTVKTTRRRRSRRRAEGSSICV----PIRRGQGSTPTPTIQVLQFVLV 116
            :|:|...: |:|.:.|        |.||......|::.|    |:.:|| .|..|   :|.::..
  Fly   196 LPSSSNASLATPTEPA--------RNRSTGLVRNSAVKVDSKHPLSKGQ-KTDAP---MLNYIFD 248

  Fly   117 SLLALLAKNAQAHNIPE--------------DAVHITAILGEGVIFNCHVEFPNDHPVPYV---L 164
            :.     .:|..|:..:              .|.::|...|..:..||.:....|..|.:|   .
  Fly   249 TF-----SSANKHHHHDQRYGPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNT 308

  Fly   165 QWDKKVSETGSDLPIYIWYESYPEHIEEGYKGRVSRVSQDSPFGSASLNLTNIRESDQGWYECKV 229
            |.:.|.:....|| :.:...:|..  ::.||     :....| .:..|.:||:::.|:..|||::
  Fly   309 QDEGKDNGNALDL-LTVGMHTYTG--DKRYK-----MEFQYP-NNWRLKITNVKKDDEAIYECQI 364

  Fly   230 VFLNRDPKQHKNGTWFHLDVHAPPRFSV----TPEDIIYVNLGDSIILNCQADGTP-TPEILWYK 289
              ....|:..:    .:|.|:||....|    .|....|..:..::.|:|...... |..::::|
  Fly   365 --STHPPRVIQ----INLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWK 423

  Fly   290 --------DANPVDPSPTVGIFNDG--TELRISTIRHEDIGEYTCIAR------------NGE-- 330
                    |......|....:..||  :.|.|:.|...|.|.|||...            |||  
  Fly   424 HMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKTDSGNYTCSISEFQNFTIVVHILNGESF 488

  Fly   331 GQVSHTARVIIAGGAV 346
            .::.|       ||||
  Fly   489 AELHH-------GGAV 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 24/115 (21%)
IG_like 137..229 CDD:214653 22/94 (23%)
I-set 253..341 CDD:254352 23/116 (20%)
IGc2 268..331 CDD:197706 19/87 (22%)
I-set 346..437 CDD:254352 1/1 (100%)
Ig 349..437 CDD:299845
Ig 459..530 CDD:299845
IG_like 549..628 CDD:214653
IGc2 551..617 CDD:197706
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
dpr20NP_612066.1 IG_like 278..365 CDD:214653 22/97 (23%)
Ig 279..378 CDD:299845 24/113 (21%)
Ig 400..471 CDD:299845 16/70 (23%)
IG_like 402..480 CDD:214653 16/77 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.