DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment tutl and babos

DIOPT Version :9

Sequence 1:	NP_001303307.1	Gene:	tutl / 46015	FlyBaseID:	FBgn0010473	Length:	1536	Species:	Drosophila melanogaster
Sequence 2:	NP_001286719.1	Gene:	babos / 37557	FlyBaseID:	FBgn0034724	Length:	196	Species:	Drosophila melanogaster

Alignment Length:	128	Identity:	26/128 - (20%)
Similarity:	41/128 - (32%)	Gaps:	45/128 - (35%)

- Green bases have known domain annotations that are detailed below.

  Fly   339 VIIAGGAVIMVP------------------------PTNQTK------------------LEGEK 361
            :|:...|||..|                        |:.|||                  :.||.
  Fly    14 LIVGSAAVISYPQSSMDDDQMQADDDFDYGGEDQSAPSPQTKSPNPVASEKINKTLSVTGIRGED 78

  Fly   362 VIFSCE--AKAMPGNVTVRWYREGSPVREVAAL-ETRVTIRKDGSLIINPIKPDDSGQYLCEV 421
            |:..|:  :.....:|.|.||...:.:.....| :....:..:..|.|....|..:|.|||:|
  Fly    79 VVLKCDVGSNLHSSDVVVLWYFGDNVISNGKNLVQPNFKLDANYDLTILKASPQVAGSYLCKV 141

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
tutl	NP_001303307.1	V-set	137..250	CDD:284989
		IG_like	137..229	CDD:214653
		I-set	253..341	CDD:254352	0/1 (0%)
		IGc2	268..331	CDD:197706
		I-set	346..437	CDD:254352	24/121 (20%)
		Ig	349..437	CDD:299845	22/118 (19%)
		Ig	459..530	CDD:299845
		IG_like	549..628	CDD:214653
		IGc2	551..617	CDD:197706
		FN3	633..725	CDD:238020
		FN3	786..874	CDD:238020
babos	NP_001286719.1	ig	70..154	CDD:278476	17/72 (24%)
babos	NP_001286719.1	IG_like	70..154	CDD:214653	17/72 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900