DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tutl and Lac

DIOPT Version :9

Sequence 1:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:409 Identity:96/409 - (23%)
Similarity:158/409 - (38%) Gaps:88/409 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LLALLAKNAQAHNIPEDAVHIT----AILGEGVIFNCHVEFPNDHPVPYVLQWDKKVSETGSDLP 178
            |||:..:...|...|..: :||    ..:|..|.|:|.|::..::.|.::        :|.|| |
  Fly    15 LLAIFVQQTLAQRTPTIS-YITQEQIKDIGGTVEFDCSVQYAKEYNVLFL--------KTDSD-P 69

  Fly   179 IYIWYESYPEHIEEGYKGRVSRVSQDSPF--------GSASLNLTNIRESDQGWYECKVVFLNRD 235
            :::...|             :.|.:||.|        .:..|.:.:|:|:|.|.|.|:||.    
  Fly    70 VFLSTGS-------------TLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVI---- 117

  Fly   236 PKQHKNGTWFHLDVHAPPRFSVTPEDIIYVNLGDSIILNCQADGTPTPEILWYKDANPVDPSPTV 300
            ...||......|.|..||..|......:..:.|..:.:.|.|.|.|||.|.|.::.|.:.|:.:.
  Fly   118 STVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSA 182

  Fly   301 GIFNDGTELRISTIRHEDIGEYTCIARNGEGQVSHTAR----VIIAGGAVIMVPPTNQTKLEGEK 361
            ...  |..|||.:::.||.|.|.|:|.||   ||...|    |.:....||.||.....:.....
  Fly   183 TYV--GNTLRIKSVKKEDRGTYYCVADNG---VSKGDRRNINVEVEFAPVITVPRPRLGQALQYD 242

  Fly   362 VIFSCEAKAMPGNVTVRWYREGSPVREVAALETRVTIR--------KDGSLIINPIKPDDSGQYL 418
            :...|..:|.|....| |.::...:    |.....:|.        .|.:|.:..::....|.|:
  Fly   243 MDLECHIEAYPPPAIV-WTKDDIQL----ANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYV 302

  Fly   419 CEVTNGIGDPQSASAYLSVEYPAKVTFTPTVQYLPFRLAGVVQCYIKSSPQLQYVTWTKDKRLLE 483
            |:.||..|:.:           |:|....|:  :|.......|.||..:..:...::.       
  Fly   303 CKATNRFGEAE-----------ARVNLFETI--IPVCPPACGQAYIAGAEDVSATSFA------- 347

  Fly   484 PYQMKDIVVMANGSLLFTR 502
                   :|....:|||.|
  Fly   348 -------LVGILAALLFAR 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 29/124 (23%)
IG_like 137..229 CDD:214653 24/103 (23%)
I-set 253..341 CDD:254352 29/91 (32%)
IGc2 268..331 CDD:197706 23/62 (37%)
I-set 346..437 CDD:254352 19/98 (19%)
Ig 349..437 CDD:299845 17/95 (18%)
Ig 459..530 CDD:299845 8/44 (18%)
IG_like 549..628 CDD:214653
IGc2 551..617 CDD:197706
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
LacNP_523713.2 IG_like 36..131 CDD:214653 27/120 (23%)
FR1 37..50 CDD:409353 3/12 (25%)
Ig strand A' 37..42 CDD:409353 0/4 (0%)
Ig strand B 44..51 CDD:409353 2/6 (33%)
CDR1 51..59 CDD:409353 1/7 (14%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
FR2 60..63 CDD:409353 1/2 (50%)
CDR2 67..81 CDD:409353 5/27 (19%)
Ig strand C' 68..72 CDD:409353 2/4 (50%)
Ig strand C' 79..81 CDD:409353 1/1 (100%)
FR3 84..115 CDD:409353 8/30 (27%)
Ig strand D 84..90 CDD:409353 1/5 (20%)
Ig strand E 94..102 CDD:409353 1/7 (14%)
Ig strand F 108..115 CDD:409353 3/6 (50%)
CDR3 116..124 CDD:409353 3/11 (27%)
FR4 124..130 CDD:409353 0/5 (0%)
Ig strand G 124..130 CDD:409353 0/5 (0%)
Ig_3 134..208 CDD:404760 24/75 (32%)
Ig strand B 153..157 CDD:409353 0/3 (0%)
Ig strand C 166..170 CDD:409353 1/3 (33%)
Ig strand E 187..191 CDD:409353 1/3 (33%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 1/2 (50%)
Ig 227..318 CDD:416386 21/106 (20%)
Ig strand C 256..260 CDD:409353 1/4 (25%)
Ig strand E 286..290 CDD:409353 1/3 (33%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.