DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tutl and Opcml

DIOPT Version :9

Sequence 1:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:XP_006510497.1 Gene:Opcml / 330908 MGIID:97397 Length:354 Species:Mus musculus


Alignment Length:349 Identity:86/349 - (24%)
Similarity:128/349 - (36%) Gaps:98/349 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 SQDSPFGSASLNLTNIRESDQGWYEC-------KVVFLNRDPKQHK-NGTWFHLDVHAPPRFSVT 258
            |.|:.|..|..|:| :|:.:.....|       :|.:|||....:. |..|           |:.
Mouse    33 SGDATFPKAMDNVT-VRQGESATLRCTIDDRVTRVAWLNRSTILYAGNDKW-----------SID 85

  Fly   259 PEDIIYVNLGDSIILNCQADGTPTPEILWYKDANPVDPSPTVGIFNDGTELRISTIRHEDIGEYT 323
            |..||.||             |||...:..::.:..|..|                       ||
Mouse    86 PRVIILVN-------------TPTQYSIMIQNVDVYDEGP-----------------------YT 114

  Fly   324 CIARNGEGQVSH--TARVIIAGGAVIMVPP------TNQTKLEGEKVIFSCEAKAMPGNVTVRWY 380
            |..:..    :|  |:||.:    ::.|||      ::.|..||..|...|.|...| ..||.| 
Mouse   115 CSVQTD----NHPKTSRVHL----IVQVPPQIMNISSDITVNEGSSVTLLCLAIGRP-EPTVTW- 169

  Fly   381 REGSPVREVAALETRVTIRKDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASAYLSVEYP----- 440
                  |.::..|.:..:.:|..|.|:.||.|.||:|.|...|.:..|......::|.||     
Mouse   170 ------RHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISK 228

  Fly   441 AKVTFTPTVQYLPFRLAGVVQCYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVMAN----GSLLFT 501
            ||.|.....|      .|::.|...:.|..::..:.:|.||....   |.|.:.|    .:|.|.
Mouse   229 AKNTGVSVGQ------KGILSCEASAVPMAEFQWFKEDTRLATGL---DGVRIENKGRISTLTFF 284

  Fly   502 RVNEEHQGQYACTPYNAQGTAGAS 525
            .|:|:..|.|.|...|..|...||
Mouse   285 NVSEKDYGNYTCVATNKLGNTNAS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 14/55 (25%)
IG_like 137..229 CDD:214653 8/33 (24%)
I-set 253..341 CDD:254352 18/89 (20%)
IGc2 268..331 CDD:197706 8/62 (13%)
I-set 346..437 CDD:254352 27/96 (28%)
Ig 349..437 CDD:299845 27/93 (29%)
Ig 459..530 CDD:299845 19/71 (27%)
IG_like 549..628 CDD:214653
IGc2 551..617 CDD:197706
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
OpcmlXP_006510497.1 Ig 44..132 CDD:416386 28/143 (20%)
Ig strand A' 44..49 CDD:409353 2/5 (40%)
Ig strand B 51..59 CDD:409353 1/7 (14%)
CDR1 59..63 CDD:409353 0/3 (0%)
FR2 64..70 CDD:409353 1/5 (20%)
Ig strand C 64..70 CDD:409353 1/5 (20%)
CDR2 71..83 CDD:409353 3/22 (14%)
Ig strand C' 72..76 CDD:409353 0/3 (0%)
Ig strand C' 80..83 CDD:409353 1/13 (8%)
FR3 84..118 CDD:409353 13/69 (19%)
Ig strand D 87..94 CDD:409353 4/19 (21%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 4/30 (13%)
CDR3 119..123 CDD:409353 0/7 (0%)
Ig strand G 123..132 CDD:409353 3/12 (25%)
FR4 125..132 CDD:409353 3/10 (30%)
Ig_3 135..206 CDD:404760 24/78 (31%)
Ig strand A 135..138 CDD:409353 2/2 (100%)
Ig strand A' 144..148 CDD:409353 1/3 (33%)
Ig strand B 151..160 CDD:409353 2/8 (25%)
Ig strand C 165..170 CDD:409353 3/11 (27%)
Ig strand C' 171..174 CDD:409353 0/2 (0%)
Ig strand F 198..206 CDD:409353 3/7 (43%)
Ig_3 223..300 CDD:404760 21/85 (25%)
putative Ig strand A 224..230 CDD:409353 0/5 (0%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 1/3 (33%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.