| Sequence 1: | NP_001303307.1 | Gene: | tutl / 46015 | FlyBaseID: | FBgn0010473 | Length: | 1536 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_036019026.1 | Gene: | Negr1 / 320840 | MGIID: | 2444846 | Length: | 362 | Species: | Mus musculus |
| Alignment Length: | 329 | Identity: | 84/329 - (25%) |
|---|---|---|---|
| Similarity: | 121/329 - (36%) | Gaps: | 62/329 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 261 DIIYVNLGDSIILNCQ-ADGTPTPEILWYK---------DANPVDPSPTVGIFND-GTELRISTI 314
Fly 315 RHEDIGEYTCIARNGEGQVSHTARVIIAGGAVIMVPP------TNQTKLEGEKVIFSCEAKAMPG 373
Fly 374 NVTVRWYREGSPVREVAALETRVTIRKDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASAYLSVE 438
Fly 439 YPAKVTFTPTVQYL------PFRLAGVVQCYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVMANGS 497
Fly 498 ----LLFTRVNEEHQGQYACTPYNAQGTAGASGVMDVLVR---KPPAFTVEPETLYQRKVGDSVE 555
Fly 556 MHCD 559 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| tutl | NP_001303307.1 | V-set | 137..250 | CDD:284989 | |
| IG_like | 137..229 | CDD:214653 | |||
| I-set | 253..341 | CDD:254352 | 25/90 (28%) | ||
| IGc2 | 268..331 | CDD:197706 | 19/73 (26%) | ||
| I-set | 346..437 | CDD:254352 | 24/96 (25%) | ||
| Ig | 349..437 | CDD:299845 | 24/93 (26%) | ||
| Ig | 459..530 | CDD:299845 | 21/74 (28%) | ||
| IG_like | 549..628 | CDD:214653 | 3/11 (27%) | ||
| IGc2 | 551..617 | CDD:197706 | 3/9 (33%) | ||
| FN3 | 633..725 | CDD:238020 | |||
| FN3 | 786..874 | CDD:238020 | |||
| Negr1 | XP_036019026.1 | FR1 | 38..55 | CDD:409353 | 5/14 (36%) |
| Ig strand A' | 40..46 | CDD:409353 | 2/5 (40%) | ||
| IG_like | 41..129 | CDD:214653 | 24/95 (25%) | ||
| Ig strand B | 48..56 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 56..60 | CDD:409353 | 2/5 (40%) | ||
| FR2 | 61..68 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 61..67 | CDD:409353 | 1/5 (20%) | ||
| CDR2 | 69..79 | CDD:409353 | 1/9 (11%) | ||
| Ig strand C' | 71..74 | CDD:409353 | 0/2 (0%) | ||
| Ig strand C' | 76..79 | CDD:409353 | 1/2 (50%) | ||
| FR3 | 80..115 | CDD:409353 | 11/39 (28%) | ||
| Ig strand D | 84..91 | CDD:409353 | 0/6 (0%) | ||
| Ig strand E | 94..100 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 107..115 | CDD:409353 | 4/12 (33%) | ||
| CDR3 | 116..120 | CDD:409353 | 1/3 (33%) | ||
| Ig strand G | 120..129 | CDD:409353 | 1/9 (11%) | ||
| FR4 | 122..129 | CDD:409353 | 0/7 (0%) | ||
| Ig strand A' | 139..144 | CDD:409353 | 0/4 (0%) | ||
| IGc2 | 146..204 | CDD:197706 | 19/67 (28%) | ||
| Ig strand B | 150..157 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 163..168 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C' | 170..172 | CDD:409353 | 2/9 (22%) | ||
| Ig strand E | 180..186 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 193..200 | CDD:409353 | 3/6 (50%) | ||
| Ig_3 | 219..295 | CDD:404760 | 22/79 (28%) | ||
| putative Ig strand A | 219..225 | CDD:409353 | 3/5 (60%) | ||
| Ig strand B | 235..239 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 248..252 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 274..278 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 288..293 | CDD:409353 | 2/4 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||