DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tutl and Kirrel3

DIOPT Version :9

Sequence 1:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:XP_038937320.1 Gene:Kirrel3 / 315546 RGDID:1311382 Length:869 Species:Rattus norvegicus


Alignment Length:746 Identity:164/746 - (21%)
Similarity:258/746 - (34%) Gaps:176/746 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PEDAVHITAILGEGVIFNCHV-EFPNDHPVPYVLQW--DKKVSETGSDLPIYIWYESYPEHIEEG 193
            |:|.|   .:.|:.|...|.: |:..     :|| |  |......|.||      .|||:::..|
  Rat    54 PQDQV---VVSGQPVTLLCAIPEYDG-----FVL-WIKDGLALGVGRDL------SSYPQYLVVG 103

  Fly   194 YKGRVSRVSQDSPFGSASLNLTNIRESDQGWYECKVV---FLNRDPKQHKNGTWFHLDVHAPPRF 255
                 :.:|     |...|.:......|...|||:.:   ..:|                 |.|.
  Rat   104 -----NHLS-----GEHHLKILRAELQDDAVYECQAIQAAIRSR-----------------PARL 141

  Fly   256 S--VTPED-------IIYVNLGDSIILNCQADGT-PTPEILWYKDANPVDPSP-TVGIFNDG-TE 308
            :  |.|:|       :|.:..||.:.|.|.||.. |...|:|.:....::.:. :..:..|| .|
  Rat   142 TVLVPPDDPIILGGPVISLRAGDPLNLTCHADNAKPAASIIWLRKGEVINGATYSKTLLRDGKRE 206

  Fly   309 LRIST--IRHEDIGEYTCIARNGEGQVSHTARVIIAGGAVIMV------PP------TNQTKLEG 359
            ..:||  |...|:       .||:..|.......|.||....|      ||      ..|..||.
  Rat   207 SIVSTLFISPGDV-------ENGQSIVCRATNKAIPGGKETSVTIDIQHPPLVNLSVEPQPVLED 264

  Fly   360 EKVIFSCEAKAMPGNVTVRWYREGSPVREVAALETRVTIRKDGSLIINPIKPDDSGQYLCEVTNG 424
            ..|.|.|.|||.|.....||.:.|..::|.:....|.|:  |.:....|:.        |||||.
  Rat   265 NIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRTTV--DYTYFSEPVS--------CEVTNA 319

  Fly   425 IGDPQSASAYLSVEYPAKVTFTPTVQYLPFRLAGVVQCYIKSSPQLQYVTWTKDKRLLEPYQMKD 489
            :|. .:.|..:.|.:..::|..|....:......|..|....:|.|. :.|.|        :...
  Rat   320 LGS-TNLSRTVDVYFGPRMTSEPQSLLVDLGSDAVFSCAWIGNPSLT-IVWMK--------RGSG 374

  Fly   490 IVVMANGSLLFTRVNEEHQGQYACTPYNAQGTAGASGVMDVLVRKPPAFTVEPETLYQRKV-GDS 553
            :|:....:|....|.:|..|:|.|.....:..||...| .:.|..||..:   .|..|..: |:.
  Rat   375 VVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREV-TLTVNGPPIIS---STQTQHALHGEK 435

  Fly   554 VEMHCDALEAEGTERPTIKWQRQEGEQLTES-QRNRIKISGGN--------ITIENLRREDF-GY 608
            .::.|........:|....|:    |.:.|| ...|..:...|        :||.|:.|.|| ..
  Rat   436 GQIKCFIRSTPPPDRIAWSWK----ENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTI 496

  Fly   609 YQCVVSNEVATLMAVTQLVIEGTQ------------PHAPYNITGKATESSITLQWL-------- 653
            |.|...|...:...:.:|..:|::            |.|.  |.|.|..:.:....|        
  Rat   497 YNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAV--IIGVAVGAGVAFLVLMATIVAFC 559

  Fly   654 -----------PGYSG-GSEYKQDYTIWFREAGVNDWQTISVTPSGSTQVTINGLASGTTYEFQV 706
                       ||.|| |:|.|....: .|.|.:..  .:|.......::.....|||...|...
  Rat   560 CARSQRSTGGRPGISGRGTEQKARLRL-PRRANLKG--VVSAKNDIRVEIVHKEPASGREAEDHT 621

  Fly   707 VGRNVLGD-GMMSKVMTVRTLEDAPAAPRNVKAATQPPDSFFQLMPDEADLLAYFDIYFHTDSRG 770
            ..:.::.| |...:...::.||           ..:..:..||.:.|..:  .|:.:....:...
  Rat   622 TIKQLMMDRGEFQQDSVLKQLE-----------VLKEEEKEFQNLKDPTN--GYYSVNTFKEHHS 673

  Fly   771 TLVYS----PPKLRVKGPKPGPPRNVSVTEV 797
            |...|    .|.||..| |...|..:|.|.:
  Rat   674 TPTISLSSCQPDLRPTG-KQRVPTGMSFTNI 703

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 23/118 (19%)
IG_like 137..229 CDD:214653 22/94 (23%)
I-set 253..341 CDD:254352 24/101 (24%)
IGc2 268..331 CDD:197706 18/67 (27%)
I-set 346..437 CDD:254352 28/102 (27%)
Ig 349..437 CDD:299845 28/99 (28%)
Ig 459..530 CDD:299845 16/70 (23%)
IG_like 549..628 CDD:214653 19/89 (21%)
IGc2 551..617 CDD:197706 18/75 (24%)
FN3 633..725 CDD:238020 22/112 (20%)
FN3 786..874 CDD:238020 3/12 (25%)
Kirrel3XP_038937320.1 IG_like 54..143 CDD:214653 28/130 (22%)
Ig strand A' 56..60 CDD:409353 2/6 (33%)
Ig strand B 64..71 CDD:409353 2/6 (33%)
Ig strand C 78..82 CDD:409353 3/4 (75%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
Ig strand D 97..101 CDD:409353 1/3 (33%)
Ig strand E 104..116 CDD:409353 3/16 (19%)
Ig strand G 132..143 CDD:409353 3/27 (11%)
IgI_2_KIRREL3-like 149..246 CDD:409416 25/103 (24%)
Ig strand B 166..170 CDD:409416 1/3 (33%)
Ig strand C 180..184 CDD:409416 1/3 (33%)
Ig strand E 210..214 CDD:409416 2/3 (67%)
Ig strand F 224..229 CDD:409416 1/4 (25%)
Ig strand G 239..242 CDD:409416 0/2 (0%)
Ig <267..334 CDD:416386 23/77 (30%)
Ig strand B 267..274 CDD:409353 3/6 (50%)
Ig strand C 279..286 CDD:409353 2/6 (33%)
Ig strand C' 288..291 CDD:409353 1/2 (50%)
Ig strand D 298..302 CDD:409353 1/3 (33%)
Ig strand E 304..310 CDD:409353 1/5 (20%)
Ig strand G 321..334 CDD:409353 3/13 (23%)
Ig 335..416 CDD:416386 18/90 (20%)
Ig strand A' 343..347 CDD:409353 0/3 (0%)
Ig strand B 350..360 CDD:409353 2/9 (22%)
Ig strand C 365..371 CDD:409353 2/14 (14%)
Ig strand E 381..387 CDD:409353 1/5 (20%)
IgI_5_KIRREL3 418..515 CDD:409479 22/103 (21%)
Ig strand B 436..440 CDD:409479 0/3 (0%)
Ig strand C 450..454 CDD:409479 1/3 (33%)
Ig strand E 481..485 CDD:409479 0/3 (0%)
Ig strand F 496..501 CDD:409479 2/4 (50%)
Ig strand G 509..512 CDD:409479 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.