DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tutl and Mdga2

DIOPT Version :9

Sequence 1:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:XP_008762910.2 Gene:Mdga2 / 314180 RGDID:735131 Length:956 Species:Rattus norvegicus


Alignment Length:890 Identity:193/890 - (21%)
Similarity:307/890 - (34%) Gaps:255/890 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NTEKSKEQQ-----QQSQPLEI---------PEQRASKCRGDI-DRTTTTTIPASKTLTASPAKT 70
            |.|:.:..:     ::.:.||:         |:.|.:|..|.. ||...:::             
  Rat    39 NIEEERYSERVYTIREGETLELTCLVTGHPRPQIRWTKTAGSASDRFQDSSV------------- 90

  Fly    71 AAFTVKTTRRRRSRRRAEGSSICVPIRRGQGSTPTPTIQVLQFVLVSLLALLAKNAQAHNIPEDA 135
                ...|.|..|.:|.:|.........|.||....:|:|                ..:.:.:..
  Rat    91 ----FNETLRITSIQRHQGGRYYCKAENGLGSPAIKSIRV----------------DVYYLDDPV 135

  Fly   136 VHITAILGEG---------VIFNCHVEFPNDHPVPYVLQWDKKVSETGSDLPIYIWYESYPEHIE 191
            |.:...:||.         |...|...  ::.||.|..:..::|...|||..:.| ||       
  Rat   136 VTVHQSIGEAKEQFYYERTVFLRCVAN--SNPPVRYSWRRGQEVLLQGSDKGVEI-YE------- 190

  Fly   192 EGYKGRVSRVSQDSPFGSAS----LNLTNIRESDQGWYEC------------KVVFLNRDPKQHK 240
                          ||.:..    |.|.|:|..|...|.|            |:|......|.  
  Rat   191 --------------PFFTQGETKILKLKNLRPQDYANYSCIASVRNVCNIPDKMVSFRLSNKT-- 239

  Fly   241 NGTWFHLDVHAPPRFSVTPEDIIYVNLGDSIILNC-QADGTPTPEILWYKDANPVDPSPTVGIFN 304
                      |.|...:..:|.|.||.|::|.|.| ...|.|.|.:.|.:....:   |...:.|
  Rat   240 ----------ASPSIKLLVDDPIVVNPGEAITLVCVTTGGEPMPSLTWVRSFGTL---PEKIVLN 291

  Fly   305 DGTELRISTIRHEDIGEYTCIARNGEGQVSHTARVIIAGG---AVIMVPPTNQTKLE----GEKV 362
            .|| |.|..|..:|.|.|:|||.|..|..:..:..||...   ....:.|....|.:    |.:|
  Rat   292 GGT-LTIPAITSDDAGTYSCIANNNVGNPAKKSTNIIVRALKKGRFWITPDPYHKDDNIQIGREV 355

  Fly   363 IFSCEAKAMPG-NVTVRWYREGSPVREVAALETRVTIRKD-------GSLIINPIKPDDSGQYLC 419
            ..||:.:|:|. .:|..|::.|.|:|   :.|..|..:.|       .:|.|..:|..|.|.|.|
  Rat   356 KISCQVEAVPSEELTFSWFKNGRPLR---SSERMVITQTDPDVSPGTTNLDIIDLKFTDFGTYTC 417

  Fly   420 EVT---NGIGDPQSASAYLSVEYPAKVTFTPTVQYLPFRLAGVV---------QCYIKSSPQLQY 472
            ..:   .||.|       :|::.....:..|....:|...:.:|         ||.:...|: ..
  Rat   418 VASLKGGGISD-------ISIDVNISSSTVPPNLTVPQEKSPLVTREGDTIELQCQVTGKPK-PI 474

  Fly   473 VTWTK-DKRLLEP---YQMKDIVVMANGSLLFTRVNEEHQGQYAC--TPYNAQGTAGASGVMDVL 531
            :.|:: ||.:..|   .||:..    :|:|....|:.|..|.|.|  :.||.........::.::
  Rat   475 ILWSRADKEVAMPDGTMQMESY----DGTLRIVNVSREMSGMYRCQTSQYNGFNVKPREALVQLI 535

  Fly   532 VRKPPAFTVEPETLYQRKVGD-SVEMHCDALEAEGTERPTIKWQ---------RQEGEQLTESQR 586
            |:.|||  |||..|..|:..| ||.|.|..|.|......|.:|:         :.:.::.||   
  Rat   536 VQYPPA--VEPAFLEIRQGQDRSVTMSCRVLRAYPIRVLTYEWRLGNKLLRTGQFDSQEYTE--- 595

  Fly   587 NRIKISGGNITIENLRREDFGYYQCVVSNEVATLMAVTQLVIEGTQPHAPYNITGKATES----- 646
                     ..:::|..|::|.|.|.:.||...             ....:.:||||...     
  Rat   596 ---------YPLKSLSNENYGVYNCSIINEAGA-------------GRCSFLVTGKAYAPEFYYD 638

  Fly   647 -------------SITLQWLPGYSGGSEYKQDYTIWFREAGVNDWQTISVTPSGSTQ----VTIN 694
                         |.:|||........:....|.:..|:||...|....:..:|:.|    :|.|
  Rat   639 TYNPVWQNRHRVYSYSLQWTQMNPDAVDRIVAYRLGIRQAGQQRWWEQEIKINGNIQKGELITYN 703

  Fly   695 --GLASGTTYEFQVVGRNVLGDGMMSKVMTVRTLE-DAPAAPR-----------NVKAATQPPDS 745
              .|.....||.::......|:|    ..|:|.:: .||..|.           |:...||    
  Rat   704 LTELIKPEAYEVRLTPLTKFGEG----DSTIRVIKYTAPVNPHLREFHCGFEDGNICLFTQ---- 760

  Fly   746 FFQLMPDEADLLAYFDIYFHTDSRGTLVYSP---PKLRVKGPKPG 787
                  |:.|   .||....:.:.....|:|   |.....|.|.|
  Rat   761 ------DDTD---NFDWTKQSTATRNTKYTPNTGPNADRSGSKEG 796

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 26/137 (19%)
IG_like 137..229 CDD:214653 23/116 (20%)
I-set 253..341 CDD:254352 28/88 (32%)
IGc2 268..331 CDD:197706 22/63 (35%)
I-set 346..437 CDD:254352 26/105 (25%)
Ig 349..437 CDD:299845 26/102 (25%)
Ig 459..530 CDD:299845 19/85 (22%)
IG_like 549..628 CDD:214653 18/88 (20%)
IGc2 551..617 CDD:197706 17/75 (23%)
FN3 633..725 CDD:238020 23/115 (20%)
FN3 786..874 CDD:238020 1/2 (50%)
Mdga2XP_008762910.2 IG 48..128 CDD:214652 18/112 (16%)
Ig_3 134..219 CDD:404760 24/108 (22%)
Ig strand B 155..159 CDD:409353 1/3 (33%)
Ig strand C 168..172 CDD:409353 1/3 (33%)
Ig strand E 199..203 CDD:409353 1/3 (33%)
Ig strand F 213..218 CDD:409353 2/4 (50%)
Ig strand A 244..248 CDD:409353 0/3 (0%)
IGc2 256..317 CDD:197706 22/64 (34%)
Ig strand B 258..268 CDD:409353 3/9 (33%)
Ig strand C 274..278 CDD:409353 0/3 (0%)
Ig strand C' 280..282 CDD:409353 0/1 (0%)
Ig strand D 287..292 CDD:409353 0/4 (0%)
Ig strand E 293..299 CDD:409353 4/6 (67%)
Ig strand F 306..314 CDD:409353 5/7 (71%)
Ig 349..424 CDD:416386 21/77 (27%)
Ig strand B 355..359 CDD:409353 1/3 (33%)
Ig strand C 370..374 CDD:409353 1/3 (33%)
Ig strand E 400..404 CDD:409353 1/3 (33%)
Ig strand F 414..419 CDD:409353 2/4 (50%)
Ig strand G 428..431 CDD:409353 1/9 (11%)
Ig_3 441..518 CDD:404760 19/81 (23%)
Ig strand B 461..468 CDD:409353 2/6 (33%)
Ig strand C 474..479 CDD:409353 1/4 (25%)
Ig strand C' 482..484 CDD:409353 1/1 (100%)
Ig strand D 490..494 CDD:409353 1/3 (33%)
Ig strand E 498..502 CDD:409353 2/3 (67%)
Ig strand F 511..519 CDD:409353 3/7 (43%)
MAM 748..920 CDD:395504 13/62 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.