DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tutl and dpr1

DIOPT Version :9

Sequence 1:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:262 Identity:63/262 - (24%)
Similarity:103/262 - (39%) Gaps:52/262 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RGQGSTPTPTIQVLQFVLVSLLALLAKNAQAHNIPEDAVHITAILGEGVIFNCHVEFPNDHPVPY 162
            ||..:...||........:|...||.  ....::|.   ::|..:|:....:|.||...|..|.:
  Fly    28 RGYNAALAPTPPTTSTTTISPSNLLP--YFDFDVPR---NLTVTVGQTGFLHCRVERLGDKDVSW 87

  Fly   163 VLQWDKKVSETGSDLPIYIWYESYPEHIEEGYKGRVSRVSQDSPFGSA--SLNLTNIRESDQGWY 225
            :.:.|..:...|...     |.|       ..:.:|.|     |.|||  :|.:...:..|.|.|
  Fly    88 IRKRDLHILTAGGTT-----YTS-------DQRFQVLR-----PDGSANWTLQIKYPQPRDSGVY 135

  Fly   226 ECKVVFLNRDPKQHKNGTWFHLDVHAPPRFSVTPEDIIYVNLGDSIILNCQADGTP--TPEILWY 288
            ||::   |.:||...:.|:..:::.|.   ...|.|:: |..|..|.|.|:....|  ...|.||
  Fly   136 ECQI---NTEPKMSLSYTFNVVELKAE---IFGPSDLM-VKTGSDINLTCKIMQGPHELGNIFWY 193

  Fly   289 KDA--------NPVDPS-PTVGIFNDGTE-----LRISTIRHEDIGEYTCIARNGEGQVSHTARV 339
            |.:        |.:|.| ..:.:.:|.|:     |:|......|.|.|||:.     .|:.|:.|
  Fly   194 KGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVP-----TVAKTSSV 253

  Fly   340 II 341
            .:
  Fly   254 YV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989 27/114 (24%)
IG_like 137..229 CDD:214653 23/93 (25%)
I-set 253..341 CDD:254352 27/103 (26%)
IGc2 268..331 CDD:197706 21/78 (27%)
I-set 346..437 CDD:254352
Ig 349..437 CDD:299845
Ig 459..530 CDD:299845
IG_like 549..628 CDD:214653
IGc2 551..617 CDD:197706
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
dpr1NP_001286645.1 Ig 59..154 CDD:299845 28/117 (24%)
IG_like 60..150 CDD:214653 27/112 (24%)
IG_like 163..257 CDD:214653 27/99 (27%)
Ig 174..244 CDD:143165 19/69 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.