DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tutl and rig-3

DIOPT Version :9

Sequence 1:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:NP_509155.1 Gene:rig-3 / 180958 WormBaseID:WBGene00004370 Length:487 Species:Caenorhabditis elegans


Alignment Length:551 Identity:101/551 - (18%)
Similarity:174/551 - (31%) Gaps:188/551 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 IYVNLGDSIILNCQADGTP---TPEILWYK-DANPVD----PSPTVGIFND------GTELRIST 313
            |.|..|..::::|..:...   ..::||.: :.|.:|    ||....|.|:      .|.|..|:
 Worm    49 ITVREGKKLMVSCVFESDEQIHKSDLLWKQANGNNIDGESNPSLFSVILNEKGSKHRKTSLHFSS 113

  Fly   314 IRHEDIGEYTCIARNGEGQ-VSHTARVIIAGGAVIMVPPTNQTKLEGEKVIFSCEAKAMPGNVTV 377
            :...|.|.|||..|...|: ...|.::::..........|.:..|.||.:...|..|...|.   
 Worm   114 VHTRDTGLYTCTGRTAGGENFEKTIKLVV
LPAIEWNDKDTVKGALLGEPITIDCGVKGPSGK--- 175

  Fly   378 RWYREGSPVREVAALETRVTIRKDGSLIINPIKPDDSGQYLCEVTNGIGDPQS------ASAYLS 436
                                                  :.:.::|||.|:|..      |....:
 Worm   176 --------------------------------------EPMIQMTNGNGEPLDEEIWTIAGNEAT 202

  Fly   437 VEYPAKVTFTPTVQYLPFRLAGVVQCYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVMANGSLLFT 501
            ::...|.....||..:      .::.:.::|.:...|...||.. :|.|.:.:.           
 Worm   203 IDSLKKEHAELTVSCI------TIEMHQETSKEEFPVVDRKDVN-IEVYTLPEF----------- 249

  Fly   502 RVNEEHQGQYACTPYNAQGTAGASGVMDVLVRKPPAFTVEPETLYQRKVGDSVEMHCDALEAEGT 566
              ..|...||         |...:.|.|.::......:..|...|....||              
 Worm   250 --ETEESVQY---------TVIDNHVRDAIIYCNVTHSFPPVRHYTFYHGD-------------- 289

  Fly   567 ERPTIKWQRQEGEQLTESQRNRIKIS-----GGNITIENLRREDFGYYQCVVSNEVATLMAVTQL 626
                        |::..|.:..|.::     |.::.|.|:...|.|.|:|..:|    :.|.:..
 Worm   290 ------------EEIKMSDKFNIFVNVGVSQGAHLKIHNVNENDLGTYKCEANN----IKAKSYH 338

  Fly   627 VIEGTQPHAPYNITGKATESSITLQWLPGYSGGSEYKQDYTIWFRE------------------- 672
            .|...:.:||       .|..:||         .|.|:...||..|                   
 Worm   339 TIHLREANAP-------AEPKVTL---------IEDKRHSIIWKVESIDRDPDLPMTAVEIRHLR 387

  Fly   673 ------AGVND-------WQTISVTPSGSTQ----VTINGLASGTTY--EFQVVGRNVLGDGMMS 718
                  :||:|       |::.|:....:.:    ..||||..|..|  .|:.:.....||   |
 Worm   388 AGTAEASGVSDEDISDAYWKSHSIFMQRNIKDDGIYEINGLRHGHEYVWRFRQINEAGFGD---S 449

  Fly   719 KVMTVRTLEDAPAAPRNVKAATQPPDSFFQL 749
            .|:..:||:|     .:::......||.|.|
 Worm   450 VVLRAKTLDD-----HDLEMMDSASDSKFPL 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 137..250 CDD:284989
IG_like 137..229 CDD:214653
I-set 253..341 CDD:254352 23/92 (25%)
IGc2 268..331 CDD:197706 19/76 (25%)
I-set 346..437 CDD:254352 13/96 (14%)
Ig 349..437 CDD:299845 13/93 (14%)
Ig 459..530 CDD:299845 11/70 (16%)
IG_like 549..628 CDD:214653 14/83 (17%)
IGc2 551..617 CDD:197706 13/70 (19%)
FN3 633..725 CDD:238020 26/129 (20%)
FN3 786..874 CDD:238020
rig-3NP_509155.1 IG_like 48..142 CDD:214653 23/92 (25%)
Ig 267..341 CDD:319273 16/103 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10075
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.