DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tutl and Ncam1

DIOPT Version :10

Sequence 1:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus


Alignment Length:954 Identity:211/954 - (22%)
Similarity:334/954 - (35%) Gaps:294/954 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 GQGSTPTPTIQVLQFVLVSLLALLAKNAQAHNIPEDAVHITAILGEGVIFNCHVEFPNDHPVPYV 163
            |..|..|..:::.|       .|:.|||..   |::...     ||..:..|.|           
Mouse   103 GTQSEATVNVKIFQ-------KLMFKNAPT---PQEFKE-----GEDAVIVCDV----------- 141

  Fly   164 LQWDKKVSETGSDLPIYIWYESYPEHIEEGYKGRVSRVSQDSPF---GSASLNLTNIRESDQGWY 225
                     ..|..|..||          .:|||...:.:|..|   .:..|.:..|:::|:|.|
Mouse   142 ---------VSSLPPTIIW----------KHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTY 187

  Fly   226 ECKVVFLNRDPKQHKNGTWFHLDVHAPPRFSVTPEDII--YVNLGDSIILNCQADGTPTPEILWY 288
            .|:...|.|.....|:   ..:.|:.||..... :.|:  ..|||.|:.|.|.|||.|.|.:.|.
Mouse   188 RCEGRILARGEINFKD---IQVIVNVPPTVQAR-QSIVNATANLGQSVTLVCDADGFPEPTMSWT 248

  Fly   289 KDANPV---DPSPTVGIF-NDGTELRISTIRHEDIGEYTCIARNGEGQVSHTARV-IIAGGAVIM 348
            ||..|:   :......|| :|.:||.|..:...|..||.|||.|..|:...:..: :.|...:..
Mouse   249 KDGEPIENEEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENKAGEQDASIHLKVFAKPKITY 313

  Fly   349 VPPTNQTKLE-GEKVIFSCEAKAMP-GNVTVR-------------WYREGSPVREVAALETRVTI 398
            |  .|||.:| .|:|..:|||...| .::|.|             |.|   |.:: ..|:..:.:
Mouse   314 V--ENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTR---PEKQ-ETLDGHMVV 372

  Fly   399 R---KDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASAYLSVEYPAKVTFTPTVQYLPFRLAGVV 460
            |   :..||.:..|:..|:|:|:|..:|.||. .|.|.||.|:|..|             |.|.|
Mouse   373 RSHARVSSLTLKSIQYTDAGEYICTASNTIGQ-DSQSMYLEVQYAPK-------------LQGPV 423

  Fly   461 QCYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVMANGSLLFTRVNEEHQGQYACTPYNAQGTAGAS 525
            ..|          ||.                                                 
Mouse   424 AVY----------TWE------------------------------------------------- 429

  Fly   526 GVMDVLVRKPPAFTVEPETLYQRKVGDSVEMHCDALEAEGTERPTIKWQRQEGEQLTESQRNRIK 590
                                     |:.|.:.|:.......   ||.|.| :|:.|..|..:.||
Mouse   430 -------------------------GNQVNITCEVFAYPSA---TISWFR-DGQLLPSSNYSNIK 465

  Fly   591 I----SGGNITIENLRREDFGYYQCVVSNEVATLMAVTQLVIEGTQPHAPYNITGKATESSITLQ 651
            |    |...:.:......|||.|.|...|.:.. .::..::::...|.:|.....:...|:..:|
Mouse   466 IYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQ-ESLEFILVQADTPSSPSIDRVEPYSSTAQVQ 529

  Fly   652 W-LPGYSGG---SEYKQDYTIWFREAGVNDWQTISVTPSGSTQ---VTINGLASGTTYEFQVVGR 709
            : .|..:||   .:||.::    :..|...|.........:..   |||.||...|.|..::...
Mouse   530 FDEPEATGGVPILKYKAEW----KSLGEESWHFKWYDAKEANMEGIVTIMGLKPETRYSVRLAAL 590

  Fly   710 NVLGDGMMSKVMTVRTL---EDAPAAPRN--------VKAATQPPDSFFQLMPDEADLLAYFDIY 763
            |..|.|.:|.....:|.   ...|.||.|        .:|.|.|    ..::| ..||       
Mouse   591 NGKGLGEISAATEFKTQPVHSPPPLAPANSSTLVPLSPRATTWP----LPVLP-TTDL------- 643

  Fly   764 FHTDSRGTLVYSPPKLRVKGPKPGPPRNVSVTEVSNGFLITWQSPLERAHIVKFYTIKYRTD--A 826
                |:|.  .|.|||..:..:.|....|::.:..:|     .||      ::.|.:|||..  :
Mouse   644 ----SKGE--PSAPKLEGQMGEDGNSIKVNLIKQDDG-----GSP------IRHYLVKYRAKLAS 691

  Fly   827 QWKTLNRGQIR-PEETQY-LVKNLVGGRTYYFRVLANSEKSYESSDEVKF-------PVPARVKH 882
            :||.    :|| |..:.: ::|:|.....|...|:|.:::....:....|       .:||....
Mouse   692 EWKP----EIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSP 752

  Fly   883 KA-ITAGVVGGILFFIVAIILSV---------------C-AVKICNK----RKRR---------- 916
            .| ::.|.:.|||..|..::|.|               | ||.:|.|    .|.:          
Mouse   753 TAGLSTGAIVGILIVIFVLLLVVMDITCYFLNKCGLLMCIAVNLCGKAGPGAKGKDMEEGKAAFS 817

  Fly   917 KQEKEFNMVACRITDARNIAANNH----HLHNRSTGSISSGQVP 956
            |.|.:..:|..|..:.|   ..||    |.....|..::..::|
Mouse   818 KDESKEPIVEVRTEEER---TPNHDGGKHTEPNETTPLTEPELP 858

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 138..250 CDD:462230 22/114 (19%)
I-set 253..341 CDD:400151 31/94 (33%)
Ig strand B 271..275 CDD:409353 1/3 (33%)
Ig strand C 284..288 CDD:409353 0/3 (0%)
Ig strand E 308..311 CDD:409353 2/2 (100%)
Ig strand F 321..326 CDD:409353 3/4 (75%)
Ig strand G 334..337 CDD:409353 0/2 (0%)
Ig 346..437 CDD:472250 32/108 (30%)
Ig strand B 362..366 CDD:409353 1/3 (33%)
Ig strand C 376..380 CDD:409353 2/16 (13%)
Ig strand E 402..406 CDD:409353 2/3 (67%)
Ig strand F 416..421 CDD:409353 2/4 (50%)
Ig strand G 430..433 CDD:409353 1/2 (50%)
Ig <459..530 CDD:472250 4/70 (6%)
Ig strand B 459..462 CDD:409353 1/2 (50%)
Ig strand C 471..476 CDD:409353 1/4 (25%)
Ig strand E 496..500 CDD:409353 0/3 (0%)
Ig strand F 510..515 CDD:409353 0/4 (0%)
Ig strand G 523..526 CDD:409353 0/2 (0%)
Ig_3 535..615 CDD:464046 19/83 (23%)
FN3 633..725 CDD:238020 22/98 (22%)
FN3 786..874 CDD:238020 19/91 (21%)
Ncam1XP_006510118.1 IgI_1_NCAM-1 20..116 CDD:409451 3/12 (25%)
Ig strand A 20..25 CDD:409451
Ig strand A' 28..32 CDD:409451
Ig strand B 34..44 CDD:409451
Ig strand C 50..56 CDD:409451
Ig strand C' 59..61 CDD:409451
Ig strand D 69..75 CDD:409451
Ig strand E 77..85 CDD:409451
Ig strand F 92..100 CDD:409451
Ig strand G 104..115 CDD:409451 2/10 (20%)
IG_like 124..190 CDD:214653 19/103 (18%)
Ig strand B 135..139 CDD:409353 0/3 (0%)
Ig strand C 148..152 CDD:409353 2/13 (15%)
Ig strand E 172..176 CDD:409353 1/3 (33%)
Ig strand F 186..191 CDD:409353 2/4 (50%)
IgI_3_NCAM-1 211..308 CDD:143207 32/97 (33%)
Ig strand A 211..216 CDD:143207 2/4 (50%)
Ig strand A' 220..226 CDD:143207 1/5 (20%)
Ig strand B 229..239 CDD:143207 4/9 (44%)
Ig strand C 243..249 CDD:143207 2/5 (40%)
Ig strand C' 251..253 CDD:143207 0/1 (0%)
Ig strand D 263..266 CDD:143207 0/2 (0%)
Ig strand E 271..277 CDD:143207 3/5 (60%)
Ig strand F 283..292 CDD:143207 5/8 (63%)
Ig strand G 295..307 CDD:143207 1/11 (9%)
IgI_NCAM-1 307..413 CDD:143277 33/112 (29%)
Ig strand A 307..312 CDD:143277 1/4 (25%)
Ig strand A' 316..320 CDD:143277 3/3 (100%)
Ig strand B 325..333 CDD:143277 3/7 (43%)
Ig strand C 339..345 CDD:143277 2/5 (40%)
Ig strand C' 348..351 CDD:143277 0/2 (0%)
Ig strand D 369..375 CDD:143277 1/5 (20%)
Ig strand E 378..384 CDD:143277 2/5 (40%)
Ig strand F 392..400 CDD:143277 3/7 (43%)
Ig strand G 403..413 CDD:143277 5/10 (50%)
IG_like 422..500 CDD:214653 24/166 (14%)
Ig strand B 433..437 CDD:409353 1/3 (33%)
Ig strand C 446..450 CDD:409353 2/3 (67%)
Ig strand E 473..477 CDD:409353 0/3 (0%)
Ig strand F 487..492 CDD:409353 2/4 (50%)
fn3 512..599 CDD:394996 20/90 (22%)
fn3 649..731 CDD:394996 23/96 (24%)
PHA03247 <905..1140 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.