DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tutl and Cntn1

DIOPT Version :10

Sequence 1:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:NP_031753.1 Gene:Cntn1 / 12805 MGIID:105980 Length:1020 Species:Mus musculus


Alignment Length:976 Identity:233/976 - (23%)
Similarity:367/976 - (37%) Gaps:238/976 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PEDAVHITAILGEGVIFNCH--VEFPNDHPVPYVLQWDKKVSETGSDLPIYIWYESYPEHIEEGY 194
            ||:...:....|:|::..|.  ..||:|....::|          ::.|::|..:          
Mouse   140 PEERPEVKVKEGKGMVLLCDPPYHFPDDLSYRWLL----------NEFPVFITMD---------- 184

  Fly   195 KGRVSRVSQDSPFGSASLNLTNIRESDQGWYEC--------KVVFLNRDPKQHKNGTWFHLDVHA 251
            |.|.  |||.    :.:|.:.|:..||:|.|.|        |.||....|.           :..
Mouse   185 KRRF--VSQT----NGNLYIANVESSDRGNYSCFVSSPSITKSVFSKFIPL-----------IPI 232

  Fly   252 PPRFSVT-PEDI------IYVNLGDSIILNCQADGTPTPEILWYKDANPVDPSPTVGIFNDGTEL 309
            |.|.:.. |.||      ||..:|.::.|.|.|.|.|.|:|.|.|...|: || |..|...|..|
Mouse   233 PERTTKPYPADIVVQFKDIYTMMGQNVTLECFALGNPVPDIRWRKVLEPM-PS-TAEISTSGAVL 295

  Fly   310 RISTIRHEDIGEYTCIARNGEGQVSHTARVIIAGGAVIMVPPTNQTKLE-GEKVIFSCEA--KAM 371
            :|..|:.||.|.|.|.|.|..|:..|.||:.:..... .|...|.|::: |..:.:.|.|  |.:
Mouse   296 KIFNIQLEDEGLYECEAENIRGKDKHQARIYVQAFPE-WVEHINDTEVDIGSDLYWPCIATGKPI 359

  Fly   372 PGNVTVRWYREGSPVREVAALETRVTIRKDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASAYLS 436
            |   |:||.:.|....:             |.|.:..:..:::|.|.|...|..|     |.|.:
Mouse   360 P---TIRWLKNGYSYHK-------------GELRLYDVTFENAGMYQCIAENAYG-----SIYAN 403

  Fly   437 VEYPAKVTFTPTVQYLPFR---LAG-----VVQCYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVM 493
            .|... :...||.:..|.:   ||.     :::|..|::|:.:: :|:|....|  .....|::.
Mouse   404 AELKI-LALAPTFEMNPMKKKILAAKGGRVIIECKPKAAPKPKF-SWSKGTEWL--VNSSRILIW 464

  Fly   494 ANGSLLFTRVNEEHQGQYACTPYNAQGTAGASGVMDVLVRKPPAFTVEPETLYQRKVGDSVEMHC 558
            .:|||....:.....|.|.|...|.:|.|.::|.:  ::..|....:.|... ...||::..|.|
Mouse   465 EDGSLEINNITRNDGGIYTCFAENNRGKANSTGTL--VITNPTRIILAPINA-DITVGENATMQC 526

  Fly   559 -----DALEAEGTERPTIKWQRQE-----GEQLT--ESQRNRIKISGGNITIENLRREDFGYYQC 611
                 .||:.      |..|....     .:::|  ..|||.:..:.|.:.|.|.:.:..|.|.|
Mouse   527 AASFDPALDL------TFVWSFNGYVIDFNKEITHIHYQRNFMLDANGELLIRNAQLKHAGRYTC 585

  Fly   612 VVSNEVATLMAVTQLVIEGTQPHAPYNITGKATE----SSITLQWLPGYSGGSEYKQDYTIWFRE 672
            .....|....|...||:.|  |..|..  |...|    :|:.|.|..|....|...: |||..:.
Mouse   586 TAQTIVDNSSASADLVVRG--PPGPPG--GLRIEDIRATSVALTWSRGSDNHSPISK-YTIQTKT 645

  Fly   673 AGVNDWQTISVTPSGSTQVTING---------LASGTTYEFQVVGRNVLGDGMMSKVMTVRTLED 728
            ...:||:.....|.     .|.|         |.....|||:||..|.||.|..| :.:.|...|
Mouse   646 ILSDDWKDAKTDPP-----IIEGNMESAKAVDLIPWMEYEFRVVATNTLGTGEPS-IPSNRIKTD 704

  Fly   729 APA---AP----------RNVKAATQPPDSFFQLMPDEADLLAY--FD---------------IY 763
            ..|   ||          |.:.....|....:....:...::|:  ||               .|
Mouse   705 GAAPNVAPSDVGGGGGTNRELTITWAPLSREYHYGNNFGYIVAFKPFDGEEWKKVTVTNPDTGRY 769

  Fly   764 FHTDSRGTLVYSPP-KLRVK-------GP----------KPGP---PRNVSVTEVSNGFL-ITWQ 806
            .|.|.  |:..|.. :::||       ||          :..|   |..|.|..:|:..: :.|:
Mouse   770 VHKDE--TMTPSTAFQVKVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWK 832

  Fly   807 SPLERAHIVKFYTIKYRTDAQW------KTLNRGQIRPEETQYLVKNLVGGRTYYFRVLA-NSEK 864
            ..||:  ||:.|.|:|     |      ...:|.|:..:|....::||:....|:..|.| ||..
Mouse   833 HVLEK--IVESYQIRY-----WAGHDKEAAAHRVQVTSQEYSARLENLLPDTQYFIEVGACNSAG 890

  Fly   865 SYESSDEV-----KFP--VPARVKHKAITAGVVGGILFFIV---AIILS----VCAVKICNKRKR 915
            ...|||.:     |.|  .|.|     |.:.|..|..:.|.   .:.||    |...||..:...
Mouse   891 CGPSSDVIETFTRKAPPSQPPR-----IISSVRSGSRYIITWDHVVALSNESTVTGYKILYRPDG 950

  Fly   916 RKQEKEFNMVACRI-----TDARNIAANNHHLHNRSTGSISSGQVPLKKYKQTRISSLTAILIAI 975
            :...|.|:.....|     .|...:.....|    |.|    |...:.:.|.:.:|:|::.|:::
Mouse   951 QHDGKLFSTHKHSIEVPIPRDGEYVVEVRAH----SDG----GDGVVSQVKISGVSTLSSSLLSL 1007

  Fly   976 L 976
            |
Mouse  1008 L 1008

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 138..250 CDD:462230 25/121 (21%)
I-set 253..341 CDD:400151 36/94 (38%)
Ig strand B 271..275 CDD:409353 1/3 (33%)
Ig strand C 284..288 CDD:409353 1/3 (33%)
Ig strand E 308..311 CDD:409353 1/2 (50%)
Ig strand F 321..326 CDD:409353 2/4 (50%)
Ig strand G 334..337 CDD:409353 1/2 (50%)
Ig 346..437 CDD:472250 21/93 (23%)
Ig strand B 362..366 CDD:409353 0/3 (0%)
Ig strand C 376..380 CDD:409353 2/3 (67%)
Ig strand E 402..406 CDD:409353 2/3 (67%)
Ig strand F 416..421 CDD:409353 2/4 (50%)
Ig strand G 430..433 CDD:409353 0/2 (0%)
Ig <459..530 CDD:472250 17/70 (24%)
Ig strand B 459..462 CDD:409353 0/2 (0%)
Ig strand C 471..476 CDD:409353 0/4 (0%)
Ig strand E 496..500 CDD:409353 3/3 (100%)
Ig strand F 510..515 CDD:409353 2/4 (50%)
Ig strand G 523..526 CDD:409353 0/2 (0%)
Ig_3 535..615 CDD:464046 20/91 (22%)
FN3 633..725 CDD:238020 28/104 (27%)
FN3 786..874 CDD:238020 27/103 (26%)
Cntn1NP_031753.1 IgI_1_Contactin-1 40..134 CDD:409436
Ig strand A 42..46 CDD:409436
Ig strand A' 49..54 CDD:409436
Ig strand B 60..68 CDD:409436
Ig strand C 73..79 CDD:409436
Ig strand C' 81..84 CDD:409436
Ig strand D 90..94 CDD:409436
Ig strand E 96..102 CDD:409436
Ig strand F 109..118 CDD:409436
Ig strand G 121..134 CDD:409436
Ig2_Contactin-2-like 142..230 CDD:409392 25/124 (20%)
Ig strand A 144..149 CDD:409392 0/4 (0%)
Ig strand B 153..159 CDD:409392 1/5 (20%)
Ig strand C 168..174 CDD:409392 0/5 (0%)
Ig strand C' 179..181 CDD:409392 0/1 (0%)
Ig strand D 186..191 CDD:409392 2/6 (33%)
Ig strand E 194..198 CDD:409392 1/3 (33%)
Ig strand F 208..216 CDD:409392 2/7 (29%)
Ig strand G 218..230 CDD:409392 4/22 (18%)
IgI_3_Contactin-1 241..328 CDD:143259 35/88 (40%)
Ig strand A 241..246 CDD:143259 3/4 (75%)
Ig strand A' 249..254 CDD:143259 2/4 (50%)
Ig strand B 257..266 CDD:143259 2/8 (25%)
Ig strand C 272..276 CDD:143259 1/3 (33%)
Ig strand C' 279..281 CDD:143259 0/1 (0%)
Ig strand D 289..292 CDD:143259 0/2 (0%)
Ig strand E 293..298 CDD:143259 1/4 (25%)
Ig strand F 306..314 CDD:143259 4/7 (57%)
Ig strand G 317..328 CDD:143259 4/10 (40%)
Ig 332..408 CDD:472250 22/97 (23%)
Ig strand B 348..352 CDD:143205 0/3 (0%)
Ig strand C 361..365 CDD:143205 2/3 (67%)
Ig strand E 374..378 CDD:143205 2/3 (67%)
Ig strand F 388..393 CDD:143205 2/4 (50%)
Ig strand G 401..404 CDD:143205 1/2 (50%)
Ig5_Contactin-1 413..501 CDD:409438 22/92 (24%)
Ig strand A 413..418 CDD:409438 2/4 (50%)
Ig strand A' 421..426 CDD:409438 0/4 (0%)
Ig strand B 430..437 CDD:409438 0/6 (0%)
Ig strand C 445..449 CDD:409438 0/4 (0%)
Ig strand D 463..466 CDD:409438 0/2 (0%)
Ig strand E 467..472 CDD:409438 3/4 (75%)
Ig strand F 480..488 CDD:409438 3/7 (43%)
Ig strand G 494..501 CDD:409438 1/8 (13%)
Ig6_Contactin 503..603 CDD:409359 24/106 (23%)
Ig strand A 503..509 CDD:409359 1/5 (20%)
Ig strand A' 512..517 CDD:409359 0/5 (0%)
Ig strand B 520..528 CDD:409359 2/7 (29%)
Ig strand C 537..541 CDD:409359 1/3 (33%)
Ig strand D 564..567 CDD:409359 0/2 (0%)
Ig strand E 568..572 CDD:409359 1/3 (33%)
Ig strand F 581..588 CDD:409359 3/6 (50%)
Ig strand G 595..599 CDD:409359 1/3 (33%)
FN3 612..699 CDD:238020 25/93 (27%)
FN3 650..>947 CDD:442628 75/316 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 695..719 6/24 (25%)
fn3 813..895 CDD:394996 23/88 (26%)
FN3 907..991 CDD:238020 19/96 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.