DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tutl and Cntn4

DIOPT Version :10

Sequence 1:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster
Sequence 2:NP_446331.1 Gene:Cntn4 / 116658 RGDID:621361 Length:1026 Species:Rattus norvegicus


Alignment Length:850 Identity:216/850 - (25%)
Similarity:328/850 - (38%) Gaps:196/850 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 GEGVIFNCHVEFPNDHPVPYVLQWDKKVSETGSDLPIYIWYESYPEHIEEGYKGRVSRVSQDSPF 207
            |:|::..|       .|.|:           ..:|. |.|.  :.||  ..|:.....|||:   
  Rat   137 GQGMVLLC-------GPPPH-----------SGELS-YAWI--FNEH--PSYQDNRRFVSQE--- 175

  Fly   208 GSASLNLTNIRESDQGWYECKVVFLNRDPKQHKNGTWFHLDVHAP---------------PRFSV 257
             :.:|.:..:.::|.|.|.|.|.          |....|..:..|               |:..|
  Rat   176 -TGNLYIAKVEKADVGNYTCVVT----------NTVTSHQVLGPPTPLILRNDGVMGEYEPKIEV 229

  Fly   258 TPEDIIYVNLGDSIILNCQADGTPTPEILWYK-DANPVDPS----PTVGIFNDGTELRISTIRHE 317
            ...:.:....|.::.|.|.|.|.|.|.|||.: |..|:...    .:.||      |.|...:.|
  Rat   230 QFPETVPAEKGSTVKLECFALGNPVPTILWRRADGKPIARKARRHKSSGI------LEIPNFQQE 288

  Fly   318 DIGEYTCIARNGEGQVSHTARVIIAGGAVIMVPPTNQTKLEG-------EKVIFSCEAKAMPGNV 375
            |.|.|.|:|.|..|:       .||.|.|......|..::..       |.|.:.|:|...| ..
  Rat   289 DAGSYECVAENSRGK-------NIAKGQVTFYAQPNWVQIINDIHVAMEESVFWECKANGRP-KP 345

  Fly   376 TVRWYREGSPVREVAALETRVTIR-KDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASAYLSV-- 437
            |.||.:.|.|      |.||..|: :.|:|.|..:...|:|.|.|...|..| ...|||.|||  
  Rat   346 TYRWLKNGDP------LLTRERIQIEQGTLNITIVNLSDAGMYQCVAENKHG-VIYASAELSVIA 403

  Fly   438 EYPAKVTFTPTV--QYLPFRLAG--VVQCYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVMANGSL 498
            |.|   .|:.|:  :....::.|  |::|..|:||:..| ||.|.:.:|.  :.:.|.:..:|:|
  Rat   404 ESP---DFSRTLLKRVTLVKVGGEVVIECKPKASPRPVY-TWRKGREILR--ENERITISEDGNL 462

  Fly   499 LFTRVNEEHQGQYACTPYNAQGTAGASGVMDVLVRKPPAFTVEPETLYQRKVGDSVEMHCDALEA 563
            ....|.:...|.|.|...|..|||.::|  :|:|:.|....|.|.:: ...||:|:.:.|.....
  Rat   463 RIINVTKSDAGSYTCIATNHFGTASSTG--NVVVKDPTKVMVPPSSM-DVTVGESIVLPCQVTHD 524

  Fly   564 EGTERPTIKWQ--------RQEGEQLTESQRNRIKISGGNITIENLRREDFGYYQCVVSNEVATL 620
            ...: ....|.        .::|:..   :|...:.|.|::.|.|::.:..|.|.|:|...|..|
  Rat   525 HSLD-IVFTWTFNGHLIDFDKDGDHF---ERVGGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDKL 585

  Fly   621 MAVTQLVIEGTQPHAPYNIT-GKATESSITLQWLPGYSGGSEYKQDYTIWFREAGVNDWQTISVT 684
            .|...|::.| .|..|..:| .:.|:::..|.|.||....|.... |.|..|......||.:|..
  Rat   586 SAAADLIVRG-PPGPPEAVTIDEITDTTAQLSWRPGPDNHSPITM-YVIQARTPFSVGWQAVSTV 648

  Fly   685 P---SGST-QVTINGLASGTTYEFQVVGRNVLGDGMMSKVMTVRTLEDA--PAAPRNVKAATQPP 743
            |   .|.| ..|:.||.....|||:.|..||:|.|..|:....|..|:|  ...|.||.......
  Rat   649 PELVDGKTFTATVVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPEVTPANVSGGGGSK 713

  Fly   744 DSF---FQLMPDE----------------------------ADLLAY------------FDI--- 762
            ...   ::.:|:|                            ||...|            |::   
  Rat   714 SELVITWETVPEELQNGRGFGYVVAFRPHGKMIWMLTVLASADASRYVFRNESVRPFSPFEVKVG 778

  Fly   763 YFHTDSRG-----TLVYSPPKLRVKGPKPGPPRNVSVTEVSNGFLITWQSPL--ERAHIVKFYTI 820
            .|:....|     |||||..:...|.|.....|::|.|::.    :.|.||:  .|..| :.|.:
  Rat   779 VFNNKGEGPFSPTTLVYSAEEEPTKPPASIFARSLSATDIE----VFWASPIGKNRGRI-QGYEV 838

  Fly   821 KYRTDAQW----KTLNRGQIRP--EETQYLVKNLVGGRTYYFRVLA-NSEKSYESSDEV----KF 874
            ||     |    |..|..:||.  .:|...:.||.|...|:..|.| ||..:..||..|    :.
  Rat   839 KY-----WRHDDKEENARKIRTVGNQTSTKITNLKGNALYHLSVKAYNSAGTGPSSAAVNVTTRK 898

  Fly   875 PVPAR 879
            |.|::
  Rat   899 PPPSQ 903

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutlNP_001303307.1 V-set 138..250 CDD:462230 22/106 (21%)
I-set 253..341 CDD:400151 26/92 (28%)
Ig strand B 271..275 CDD:409353 1/3 (33%)
Ig strand C 284..288 CDD:409353 2/3 (67%)
Ig strand E 308..311 CDD:409353 1/2 (50%)
Ig strand F 321..326 CDD:409353 2/4 (50%)
Ig strand G 334..337 CDD:409353 0/2 (0%)
Ig 346..437 CDD:472250 29/98 (30%)
Ig strand B 362..366 CDD:409353 1/3 (33%)
Ig strand C 376..380 CDD:409353 2/3 (67%)
Ig strand E 402..406 CDD:409353 2/3 (67%)
Ig strand F 416..421 CDD:409353 2/4 (50%)
Ig strand G 430..433 CDD:409353 1/2 (50%)
Ig <459..530 CDD:472250 22/70 (31%)
Ig strand B 459..462 CDD:409353 1/2 (50%)
Ig strand C 471..476 CDD:409353 2/4 (50%)
Ig strand E 496..500 CDD:409353 2/3 (67%)
Ig strand F 510..515 CDD:409353 2/4 (50%)
Ig strand G 523..526 CDD:409353 0/2 (0%)
Ig_3 535..615 CDD:464046 18/87 (21%)
FN3 633..725 CDD:238020 30/96 (31%)
FN3 786..874 CDD:238020 28/100 (28%)
Cntn4NP_446331.1 Ig 25..120 CDD:472250
Ig strand B 46..50 CDD:409353
Ig strand C 59..63 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 97..102 CDD:409353
Ig strand G 111..114 CDD:409353
Ig 129..213 CDD:472250 23/112 (21%)
Ig strand B 140..144 CDD:409353 0/3 (0%)
Ig strand C 154..158 CDD:409353 1/4 (25%)
Ig strand E 177..181 CDD:409353 1/3 (33%)
Ig strand F 191..196 CDD:409353 2/4 (50%)
Ig strand G 207..210 CDD:409353 0/2 (0%)
Ig 225..313 CDD:472250 30/100 (30%)
Ig strand B 243..247 CDD:409353 1/3 (33%)
Ig strand C 256..260 CDD:409353 2/3 (67%)
Ig strand E 278..282 CDD:409353 3/9 (33%)
Ig strand F 292..297 CDD:409353 2/4 (50%)
Ig strand G 305..308 CDD:409353 2/2 (100%)
Ig 318..401 CDD:472250 27/90 (30%)
Ig strand B 333..337 CDD:143205 1/3 (33%)
Ig strand C 346..350 CDD:143205 2/3 (67%)
Ig strand E 367..371 CDD:143205 2/3 (67%)
Ig strand F 381..386 CDD:143205 2/4 (50%)
Ig strand G 394..397 CDD:143205 1/2 (50%)
Ig 406..494 CDD:472250 27/95 (28%)
Ig strand B 425..429 CDD:409353 1/3 (33%)
Ig strand C 438..442 CDD:409353 2/4 (50%)
Ig strand E 460..464 CDD:409353 2/3 (67%)
Ig strand F 474..479 CDD:409353 2/4 (50%)
Ig strand G 487..490 CDD:409353 0/2 (0%)
Ig6_Contactin-4 496..597 CDD:409439 23/106 (22%)
Ig strand A 496..502 CDD:409439 1/5 (20%)
Ig strand A' 505..510 CDD:409439 0/5 (0%)
Ig strand B 513..521 CDD:409439 2/7 (29%)
Ig strand C 530..534 CDD:409439 0/3 (0%)
Ig strand D 555..558 CDD:409439 0/2 (0%)
Ig strand E 559..563 CDD:409439 1/3 (33%)
Ig strand F 572..579 CDD:409439 3/6 (50%)
Ig strand G 586..590 CDD:409439 1/3 (33%)
FN3 597..690 CDD:238020 30/93 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 685..710 7/24 (29%)
FN3 703..792 CDD:238020 11/88 (13%)
FN3 <769..>1014 CDD:442628 40/144 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.