DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and Cers1

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_619588.1 Gene:Cers1 / 93898 MGIID:2136690 Length:350 Species:Mus musculus


Alignment Length:122 Identity:27/122 - (22%)
Similarity:39/122 - (31%) Gaps:37/122 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 AGGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMN 342
            |...:|....|.|:..|               .::...:|  |.....|..| |.|.:.| .:..
Mouse     3 AAAATPRLEAPEPMPSY---------------AQMLQRSW--ASALAAAQGC-GDCGWGL-ARRG 48

  Fly   343 ATNHAIVQTLMHLKQPHLPKPCCVPTVLGAI--TILRYLNEDIIDLTKYQKAVAKEC 397
            ...||           ||..|..:..||.|:  |.||:     ...|...:.:||.|
Mouse    49 LAEHA-----------HLAAPELLLAVLCALGWTALRW-----AATTHIFRPLAKRC 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078
TGFB 300..400 CDD:214556 22/100 (22%)
Cers1NP_619588.1 TLC 98..311 CDD:214789
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.