DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and BMP15

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_005439.2 Gene:BMP15 / 9210 HGNCID:1068 Length:392 Species:Homo sapiens


Alignment Length:421 Identity:94/421 - (22%)
Similarity:167/421 - (39%) Gaps:57/421 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLNVFFLTSLFYAASATTYVTTNNHIEMPIYQKRPLSEQMEMIDILDLGDRPRRQAEPNLHNSAS 65
            :|.:.||..|.........:.......:.:..:.|....:|.:.....|::||:   |.|...:.
Human     6 ILRILFLCELVLFMEHRAQMAEGGQSSIALLAEAPTLPLIEELLEESPGEQPRK---PRLLGHSL 67

  Fly    66 KFLLEVYNEISEDQEPKEVLHQRHKRSLDDDIL-----ISNEDRQEIASCN-SILTFSSRLKPEQ 124
            :::||:|...::...     |.|..|::...::     ::|..|....:.: .||.|.  |:|.:
Human    68 RYMLELYRRSADSHG-----HPRENRTIGATMVRLVKPLTNVARPHRGTWHIQILGFP--LRPNR 125

  Fly   125 -LDNELDMHITFNTNDVPVDLSLVQAMLRIYKQPSLVDRRANFTVSVYRKLDNRQDFSYRILGSV 188
             |...:...:.:..:     |.|.:..|..:.:|.:.....|...|      :..|.|...|.| 
Human   126 GLYQLVRATVVYRHH-----LQLTRFNLSCHVEPWVQKNPTNHFPS------SEGDSSKPSLMS- 178

  Fly   189 NTTSSQRGWLEFNLTDTL--RYWLHNKGLQRRNELRISIGDSQLSTFAAGLVTPQASRTSLEPFI 251
                  ..|.|.::|..:  |:| :||| .|...||..   .|....:.||.....:.:....|:
Human   179 ------NAWKEMDITQLVQQRFW-NNKG-HRILRLRFM---CQQQKDSGGLELWHGTSSLDIAFL 232

  Fly   252 VGYFNGPELLVKIQKLRF-KRDLEK-----------RRAGGGSPPPPPPPPVDLYRPPQSCERLN 304
            :.|||  :....|:|.:| .|.:|:           |:|.|.|.................|....
Human   233 LLYFN--DTHKSIRKAKFLPRGMEEFMERESLLRRTRQADGISAEVTASSSKHSGPENNQCSLHP 295

  Fly   305 FTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMH-LKQPHLPKPCCVPT 368
            |.:.|::|...:|:|||..:...:|.|.|...|...:|:.||||:|.|:: |....:|:|.|||.
Human   296 FQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPY 360

  Fly   369 VLGAITILRYLNEDIIDLTKYQKAVAKECGC 399
            ....|::|.......|...:|:..:|:.|.|
Human   361 KYVPISVLMIEANGSILYKEYEGMIAESCTC 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 45/223 (20%)
TGFB 300..400 CDD:214556 32/101 (32%)
BMP15NP_005439.2 TGF_beta 291..391 CDD:306518 31/99 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.