DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and INHBE

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_113667.1 Gene:INHBE / 83729 HGNCID:24029 Length:350 Species:Homo sapiens


Alignment Length:330 Identity:78/330 - (23%)
Similarity:128/330 - (38%) Gaps:79/330 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 KPEQLDNELDMHITF--NTNDVPVDLSLVQAMLRIYKQP-SLVDRRANFTVSVYRKLDNRQDFSY 182
            |.:.||.   :|:|.  .....|...:|.:|:.|:  || |:........:|.....|:...:|.
Human    48 KQQILDG---LHLTSRPRITHPPPQAALTRALRRL--QPGSVAPGNGEEVISFATVTDSTSAYSS 107

  Fly   183 RILGSVNTTSSQ-----RGWLEF--NLTDTLRYWLHNKGLQRRN--------ELRI-SIGDSQLS 231
            .:...::|..|.     |.||..  .|..||...:...|.:||.        |..| ::|...|:
Human   108 LLTFHLSTPRSHHLYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLT 172

  Fly   232 TFAAGL----------------------VTPQASRT-----SLEPFIVGYFNGPELLVKIQKLRF 269
            ..::||                      ||.|..|.     ..:||:       ||.::..:...
Human   173 LPSSGLRGEKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFL-------ELKIRANEPGA 230

  Fly   270 KRDLEKRRAGGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCN 334
            .|  .:||    :|...|..|:        |.|.:..|||:||...:|::.|:.::..:|.|.|.
Human   231 GR--ARRR----TPTCEPATPL--------CCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCP 281

  Fly   335 FPLGTK--MNATNHAIVQTLMHLKQP-HLPKPCCVPTVLGAITILRYL--NEDIIDLTKYQKAVA 394
            ..|...  :.|:.|:.|.:|:....| .....|||||....:::| ||  |.:::. |.....|.
Human   282 PHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLL-YLDHNGNVVK-TDVPDMVV 344

  Fly   395 KECGC 399
            :.|||
Human   345 EACGC 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 38/178 (21%)
TGFB 300..400 CDD:214556 32/105 (30%)
INHBENP_113667.1 TGF_beta 247..349 CDD:306518 30/103 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.