DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and GDF5

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_000548.2 Gene:GDF5 / 8200 HGNCID:4220 Length:501 Species:Homo sapiens


Alignment Length:405 Identity:107/405 - (26%)
Similarity:166/405 - (40%) Gaps:56/405 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PLSEQMEMIDILDLGDRPRRQAEPNLHNSASKFLLEVYNEISEDQEPKEVLH----QRHKRSLDD 95
            |.:.|.....:...|..|..:|.|...:..|.|||:...|....:||||...    ..|:..|..
Human   112 PQTRQATARTVTPKGQLPGGKAPPKAGSVPSSFLLKKAREPGPPREPKEPFRPPPITPHEYMLSL 176

  Fly    96 DILISNEDRQ--------EIASCNSILTFSSRLKPEQLDNELDMHITFNTNDVPVDLSLVQAMLR 152
            ...:|:.||:        |....|:|.:|..:.:.::..........|:.:.:..| .|:.|.||
Human   177 YRTLSDADRKGGNSSVKLEAGLANTITSFIDKGQDDRGPVVRKQRYVFDISALEKD-GLLGAELR 240

  Fly   153 IY-KQPSLV--------DRRANFTVSVYRKLDNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRY 208
            |. |:||..        .|.|...:|...  ..||..:...:.||...... ||..|::....|.
Human   241 ILRKKPSDTAKPAAPGGGRAAQLKLSSCP--SGRQPAALLDVRSVPGLDGS-GWEVFDIWKLFRN 302

  Fly   209 WLHNKGLQRRNELRISIGDSQLSTFAAGLVTPQASRTSLEP--FIV-GYFNGPELLVKIQKLRFK 270
            :.::..|.    |.:...:...:....||...:|:|...|.  |:| |.....:|.....|.|..
Human   303 FKNSAQLC----LELEAWERGRAVDLRGLGFDRAARQVHEKALFLVFGRTKKRDLFFNEIKARSG 363

  Fly   271 RD-----------LEKRRAGGGSPPPPPPPPVDLYRPPQS----CERLNFTVDFKELHMHNWVIA 320
            :|           ..||||        |.......||.::    |.|....|:||::...:|:||
Human   364 QDDKTVYEYLFSQRRKRRA--------PLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIA 420

  Fly   321 PKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQPH-LPKPCCVPTVLGAITILRYLNEDII 384
            |.::||:.|.|.|.|||.:.:..||||::||||:...|. .|..|||||.|..|:||...:.:.:
Human   421 PLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNV 485

  Fly   385 DLTKYQKAVAKECGC 399
            ...:|:..|.:.|||
Human   486 VYKQYEDMVVESCGC 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 53/238 (22%)
TGFB 300..400 CDD:214556 41/101 (41%)
GDF5NP_000548.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..169 15/56 (27%)
TGFb_propeptide 145..344 CDD:279078 45/206 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..265 4/18 (22%)
TGFB 400..501 CDD:214556 41/101 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.