DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and ndr1

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_571041.1 Gene:ndr1 / 799352 ZFINID:ZDB-GENE-990415-256 Length:392 Species:Danio rerio


Alignment Length:303 Identity:78/303 - (25%)
Similarity:134/303 - (44%) Gaps:49/303 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 ITFNTNDVPVDLSLVQAMLRIYKQPSLVDRRANFTVSVYR----KLDNRQDFSYRI-LGSVN--- 189
            :||:.:.:.....:.:|.||| :.|.|   |:...|.:|.    :.:.......|: ||::|   
Zfish   104 VTFDMSSISASDDVQRAELRI-RLPHL---RSELEVDIYHASTPECERSPCEEVRVHLGTLNANP 164

  Fly   190 -TTSSQRGWLEFNLTDTLRYWLHNKGLQRRNELRISIGD-SQLSTFAAG---LVTPQASRTSLEP 249
             .::.:..|..||:|..|:||||...       |:...: :|:...|.|   :..|.|:|..:  
Zfish   165 INSTFRSSWRIFNITALLKYWLHQSE-------RVPFEEPTQMPPMAEGHKSVHHPTANRVMM-- 220

  Fly   250 FIVGYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPP---------------------PPPPVDL 293
            .:....|..:....|:.....:.:...||||||.|.|                     |....:.
Zfish   221 VVYSKQNRAKTSTLIRTAEHSKYVALDRAGGGSEPVPRRHRRNHRTDDRVRDAAAGMIPGVSHEG 285

  Fly   294 YRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQP 358
            ......|::::..|||.::...:|::.||::.||.|.|.|..|:......||||.:|:|:.|..|
Zfish   286 GEKKPLCKKVDMWVDFDQIGWSDWIVYPKRYNAYRCEGSCPTPVDETFTPTNHAYMQSLLKLHHP 350

  Fly   359 -HLPKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGCH 400
             .:|...||||.|..:::|.|.|..:: :..::..|..|||||
Zfish   351 DRVPCLSCVPTRLAPLSMLYYENGKMV-MRHHEGMVVAECGCH 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 31/133 (23%)
TGFB 300..400 CDD:214556 34/100 (34%)
ndr1NP_571041.1 TGFb_propeptide 56..190 CDD:279078 24/89 (27%)
TGF_beta 291..391 CDD:278448 33/100 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.