DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and admp

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001039157.1 Gene:admp / 733983 XenbaseID:XB-GENE-485379 Length:390 Species:Xenopus tropicalis


Alignment Length:411 Identity:107/411 - (26%)
Similarity:174/411 - (42%) Gaps:88/411 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SEQMEMIDILDLGDRPRRQAEPNL-HNSASKFLLEVYNEISEDQEPKEVLHQRHKRSLDDDILIS 100
            |...:::|..||     ...:|.| .:.|.|.||||:. |.|...|.:.:.|..:..:|....::
 Frog    21 SRPTDIVDTTDL-----ELEDPELVRSQALKRLLEVFG-IEEPPHPLQHVKQPPQYMVDLYNTVA 79

  Fly   101 NED----RQEIASCNSILTFSSRLKPEQLDNELDMHITFNTNDVPVDLSLVQAMLRIYKQPSLVD 161
            :||    ..::...|::.:|..::..:.      ||..||.:.|..:..::.|.|.::|......
 Frog    80 DEDGVTKDPDLLEGNTVRSFFDKIHSDH------MHFLFNLSTVARNEKILTAELHLFKLKPRPS 138

  Fly   162 RRANF------TVSVYRKLDNRQ---DFSYRILGSVNTTSSQRGWLEFNLTDTLRYW---LHNKG 214
            .:|.|      .:|||..||..:   ....::|.|........||..|::|..:|.|   ..|.|
 Frog   139 EQAYFKRHHFCQISVYLVLDKNKIQLPQGRKLLSSKLVPIHSSGWEVFSITQAVRAWNDESANHG 203

  Fly   215 L--QRRNELRISIGDSQLS----TFAAGLVTPQASRTSLEPFIVGYF------------------ 255
            :  ..||     :|.:|:.    .||:|    :....|.:|.:|.:.                  
 Frog   204 ILVTVRN-----LGGAQVDPNIIRFASG----RDHHESKQPMLVLFTDDGRRGIVSVNNQPDGQM 259

  Fly   256 ----NGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHN 316
                ||| .:....:.|..|.:|    ..|..|               |:|....|||:|:....
 Frog   260 VPLPNGP-FVPASNRTRISRSVE----DDGQLP---------------CQRHPLYVDFEEIGWSG 304

  Fly   317 WVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMH-LK-QPHLPKPCCVPTVLGAITILRYL 379
            |:|:|:.:.||.|.|.|.||||..|..||||.||:::: || ...:..|||||..|.:|.:|.:.
 Frog   305 WIISPRGYNAYHCKGSCPFPLGQNMRPTNHATVQSIINALKLTKGVSSPCCVPDKLFSINLLYFD 369

  Fly   380 NEDIIDLTKYQKAVAKECGCH 400
            :::.:.|.:|...||..||||
 Frog   370 DDENVVLKQYDDMVAGSCGCH 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 55/237 (23%)
TGFB 300..400 CDD:214556 41/101 (41%)
admpNP_001039157.1 TGFb_propeptide 46..240 CDD:366248 49/209 (23%)
TGF_beta_ADMP 287..390 CDD:381643 42/117 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.