DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and TGFB2

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001129071.1 Gene:TGFB2 / 7042 HGNCID:11768 Length:442 Species:Homo sapiens


Alignment Length:459 Identity:97/459 - (21%)
Similarity:174/459 - (37%) Gaps:82/459 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLNVFFLTSLFYAASATTYVTTNNHIEMPIY-QKRPLSEQMEMIDILDLGDRPRRQAEP------ 58
            :|:.|.:..|...|.:   ::|.:.::|..: :||..:.:.:::..|.|...|....||      
Human     5 VLSAFLILHLVTVALS---LSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEPEEVPPE 66

  Fly    59 --NLHNSASKFLLEVYNE---ISEDQEPKEVLHQRHKRSLDDDILISNEDRQEIAS--CNSILTF 116
              :::||....|.|..:.   ..|.:...|..:.:....:|......:|....:.:  ..|:.:.
Human    67 VISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSETVCPVVTTPSGSVGSL 131

  Fly   117 SSRLKPEQLDNELD-----------MHITFNTNDVPVDLS-LVQAMLRIYKQPSLVDRRANFTVS 169
            .|| :.:.|...||           ..:.|:.:.:..:.| ||:|..|:::..:...|.....:.
Human   132 CSR-QSQVLCGYLDAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIE 195

  Fly   170 VYRKLDNRQDFS--YRILGS-VNTTSSQRGWLEFNLTDTLRYWLHNKGLQRRNELRISIGDSQLS 231
            :|:.|.::...|  .|.:.| |..|.::..||.|::||.:..|||:|  .|....:||: .....
Human   196 LYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHK--DRNLGFKISL-HCPCC 257

  Fly   232 TF--AAGLVTPQASRTSLEPFIVG------YFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPP 288
            ||  :...:.|..|. .||....|      |.:|.:..:|          ..|:...|..|....
Human   258 TFVPSNNYIIPNKSE-ELEARFAGIDGTSTYTSGDQKTIK----------STRKKNSGKTPHLLL 311

  Fly   289 PPVDLYR----------------------PPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGG 331
            ..:..||                      ...:|......:|||......|:..||.:.|.||.|
Human   312 MLLPSYRLESQQTNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAG 376

  Fly   332 GCNFPLGTKMNATNHAIVQTLMHLKQPHL-PKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAK 395
            .|.:...:.   |.|:.|.:|.:...|.. ..||||...|..:|||.|:.: ...:.:....:.|
Human   377 ACPYLWSSD---TQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGK-TPKIEQLSNMIVK 437

  Fly   396 ECGC 399
            .|.|
Human   438 SCKC 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 52/250 (21%)
TGFB 300..400 CDD:214556 29/101 (29%)
TGFB2NP_001129071.1 TGFb_propeptide 21..256 CDD:395559 49/238 (21%)
TGF_beta_TGFB2 345..441 CDD:381655 28/99 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.