DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and Bmp8a

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001102902.1 Gene:Bmp8a / 680931 RGDID:1585858 Length:399 Species:Rattus norvegicus


Alignment Length:381 Identity:114/381 - (29%)
Similarity:183/381 - (48%) Gaps:44/381 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QMEMIDILDLGDRPRRQAEPNLHN---SASKFLLEVYNEISEDQEPKEVLHQRHKRSLDDDILIS 100
            |.|::.:|.|..|||.:|.|....   ||..|:|::|:.:::                |||   .
  Rat    44 QREILAVLGLPGRPRPRAPPAAARQPASAPLFMLDLYHAMTD----------------DDD---G 89

  Fly   101 NEDRQEIASCNSILTFSSRLKPEQLDNELDMH---ITFNTNDVPVDLSLVQAMLRIYKQPSLVDR 162
            ...:..:...:.:::|.:.::.::.....:.|   ..|:...:|...::..|..||||:||....
  Rat    90 GPPQAHLGRADLVMSFVNMVERDRTLGYQEPHWKEFHFDLTQIPAGEAVTAAEFRIYKEPSTHPP 154

  Fly   163 RANFTVSVYRKLDNR----QDFSYRILGSVNTTSSQRGWLEFNLTDTLRYWL--HNKGLQRRNEL 221
            .....:|::..:..|    .|..:..|.::.  |...|||..::|.....||  |||.|..|..:
  Rat   155 NTTLHISMFEVVQERSNRESDLFFLDLQTLR--SGDEGWLVLDITAASDRWLLNHNKDLGLRLYV 217

  Fly   222 RISIGDSQLSTFAAGLVTPQASRTSLEPFIVGYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPP 286
            ....|.| |....|||:...|.| |.:||:|.:|......|:..  |..|.|::|:....:..|.
  Rat   218 ETEDGHS-LDPGLAGLLGQTAPR-SRQPFMVTFFRASSSPVRTP--RAVRPLKRRQPKKTNELPH 278

  Fly   287 PPPPVDLY------RPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATN 345
            |.....::      |..:.|.|....|.|::|...:|||||:.:.||:|.|.|.|||.:.|||||
  Rat   279 PNKLPGIFDDGHGSRGREVCRRHELYVSFRDLGWLDWVIAPQGYSAYYCEGECAFPLDSCMNATN 343

  Fly   346 HAIVQTLMHLKQPH-LPKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGCH 400
            |||:|:|:||.:|. :||.||.||.|.|.::|.|.:.:.:.|.|::..|.|.||||
  Rat   344 HAILQSLVHLMKPDVVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 56/226 (25%)
TGFB 300..400 CDD:214556 47/100 (47%)
Bmp8aNP_001102902.1 TGFb_propeptide 32..248 CDD:279078 56/226 (25%)
TGF_beta 298..398 CDD:278448 46/99 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1063560at2759
OrthoFinder 1 1.000 - - FOG0000576
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X157
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.