DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and Bmp8b

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:XP_002729572.1 Gene:Bmp8b / 679119 RGDID:1591873 Length:399 Species:Rattus norvegicus


Alignment Length:425 Identity:116/425 - (27%)
Similarity:198/425 - (46%) Gaps:60/425 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VFFLTSLFYAASATTYVTTNNHIEMPIYQ---KRPLSEQMEMIDILDLGDRPRRQA------EPN 59
            :.:|..|......::::..:.|: .|.::   :.|...|.|:.::|.|..|||.:|      :| 
  Rat     7 LLWLLGLALCVLGSSHLPRSPHV-FPQHRLGVREPRDMQREIREVLGLPGRPRSRAPLATAQQP- 69

  Fly    60 LHNSASKFLLEVYNEISEDQ---EPKEVLHQRHKRSLDDDILISNEDRQEIASCNSILTFSSRLK 121
              .||..|:|.:|:.:::|.   .|:..||:                      .:.|::|.:.::
  Rat    70 --ASAPLFMLNLYHAMTDDSGNGPPQPHLHR----------------------ADLIMSFVNIVE 110

  Fly   122 PEQLDNELDMH---ITFNTNDVPVDLSLVQAMLRIYKQPSLVDRRANFTVSVYRKLDNR----QD 179
            .::.....:.|   ..|:...:|...::..|..||||:||.........:|::..:..|    .|
  Rat   111 HDRTLGYQEPHWKEFHFDLTQIPAGEAVTAAEFRIYKEPSTHPPNTTLHISMFEVVQERSNRESD 175

  Fly   180 FSYRILGSVNTTSSQRGWLEFNLTDTLRYWL--HNKGLQRRNELRISIGDSQLSTFAAGLVTPQA 242
            ..:..|.::.  |...|||..::|.....||  |||.|..|..:....|.| |....|||:...|
  Rat   176 LFFLDLQTLR--SGDEGWLVLDITAASDRWLLNHNKDLGLRLYVETEDGHS-LDPGLAGLLGQTA 237

  Fly   243 SRTSLEPFIVGYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDLY------RPPQSCE 301
            .| |.:||:||:|...:..|:..  |..|.|:|::....:..|.....:.::      ...:.|.
  Rat   238 PR-SRQPFMVGFFKASQSPVRAP--RTARPLKKKKLNQVNQLPNSNKHLGIFDDGHGSLDREVCR 299

  Fly   302 RLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQPHL-PKPCC 365
            |....|.|::|...:.||||:.:.||:|.|.|.:||.:.||:||||.:|.|:||.:|.: ||.||
  Rat   300 RHELYVSFRDLGWLDSVIAPQGYSAYYCAGECIYPLNSCMNSTNHATMQALVHLMKPDIVPKVCC 364

  Fly   366 VPTVLGAITILRYLNEDIIDLTKYQKAVAKECGCH 400
            |||.|.||::|.|...:.:.|.:.:..|.:.||||
  Rat   365 VPTKLSAISLLYYDRNNNVILRRERNMVVQACGCH 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 58/232 (25%)
TGFB 300..400 CDD:214556 43/100 (43%)
Bmp8bXP_002729572.1 TGFb_propeptide 32..248 CDD:279078 59/244 (24%)
TGF_beta 298..398 CDD:278448 42/99 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1063560at2759
OrthoFinder 1 1.000 - - FOG0000576
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X157
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.