DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and BMP8B

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:XP_011540326.2 Gene:BMP8B / 656 HGNCID:1075 Length:427 Species:Homo sapiens


Alignment Length:432 Identity:117/432 - (27%)
Similarity:188/432 - (43%) Gaps:119/432 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QMEMIDILDLGDRPRRQAEP---NLHNSASKFLLEVYNEISEDQEPKEVLHQRHKRSLDDDILIS 100
            |.|::.:|.|..|||.:|.|   .|..||..|:|::|                |..:.|||    
Human    45 QREILAVLGLPGRPRPRAPPAASRLPASAPLFMLDLY----------------HAMAGDDD---- 89

  Fly   101 NED----RQEIASCNSILTFSSRLKPEQLDNELDMH---ITFNTNDVPVDLSLVQAMLRIYKQPS 158
             ||    .:.:...:.:::|.:.::.::.....:.|   ..|:...:|...::..|..||||.||
Human    90 -EDGAPAERRLGRADLVMSFVNMVERDRALGHQEPHWKEFRFDLTQIPAGEAVTAAEFRIYKVPS 153

  Fly   159 --LVDRRANFTV-SVYRKLDNRQ-DFSYRILGSVNTTSSQRGWLEFNLTDTLRYWLHNKGLQRRN 219
              |::|..:.:: .|.::..||: |..:..|.::.  :...|||..::|.....||    |:|..
Human   154 IHLLNRTLHVSMFQVVQEQSNRESDLFFLDLQTLR--AGDEGWLVLDVTAASDCWL----LKRHK 212

  Fly   220 ELRISI----------------GDSQLSTFAAGLVTPQASRTSLEPFIVG-YFNGP-------EL 260
            :|.:.:                .||:|..:...|     |||   |:::. :..||       .|
Human   213 DLGLRLYVETEDGETWTGWGWTKDSRLQMWKLRL-----SRT---PWVLSLHAPGPAQAPAERPL 269

  Fly   261 LVKIQKLRFKRDLEKRRAGGGSPPPPPP-------PPVDLYRPPQS------------------- 299
            |..:|              |..|..|.|       .|:...:|.:|                   
Human   270 LCLLQ--------------GHCPASPSPIRTPRAVRPLRRRQPKKSNELPQANRLPGIFDDVHGS 320

  Fly   300 -----CERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQPH 359
                 |.|....|.|::|...:|||||:.:.||:|.|.|:|||.:.||||||||:|:|:||..|.
Human   321 HGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPD 385

  Fly   360 -LPKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGCH 400
             :||.||.||.|.|.::|.|.:.:.:.|.|::..|.|.||||
Human   386 AVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 56/245 (23%)
TGFB 300..400 CDD:214556 47/100 (47%)
BMP8BXP_011540326.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1063560at2759
OrthoFinder 1 1.000 - - FOG0000576
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X157
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.