DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and BMP3

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001192.4 Gene:BMP3 / 651 HGNCID:1070 Length:472 Species:Homo sapiens


Alignment Length:438 Identity:100/438 - (22%)
Similarity:164/438 - (37%) Gaps:119/438 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LNVFFLTSLFYA---ASATTYVTT----NNHIEMPIYQKRPLSEQMEMIDILDLG------DRPR 53
            |.:|.||||..:   .|||.|...    |..:..|:........|.:.|.| ||.      .|.:
Human   113 LYIFNLTSLTKSENILSATLYFCIGELGNISLSCPVSGGCSHHAQRKHIQI-DLSAWTLKFSRNQ 176

  Fly    54 RQAEPNLHNSASKFLLEVYNEISED--------QEPKEVL---------HQRHKRSL---DDDIL 98
            .|...:|....:|...::.:.:|:|        :|.:|.|         .|..||.|   :..||
Human   177 SQLLGHLSVDMAKSHRDIMSWLSKDITQLLRKAKENEEFLIGFNITSKGRQLPKRRLPFPEPYIL 241

  Fly    99 ISNEDRQEIASCNSILTFSSRLKPEQLDNELDMHITFNTNDVPVDLSLVQAMLRIYKQPSLVDRR 163
            :...|             ::..:||.:.:.|..|..|.|..||...|.::|.|.|       :||
Human   242 VYAND-------------AAISEPESVVSSLQGHRNFPTGTVPKWDSHIRAALSI-------ERR 286

  Fly   164 ANFTVSVYRKLDNRQ----DFSYRILGSVNTTSSQRGWLEFNLTDTLRYWLHNKGLQRRNELRIS 224
            ...:..|...|.|.:    ::.|:         ....|.|.....||:.....|...::.:.:  
Human   287 KKRSTGVLLPLQNNELPGAEYQYK---------KDEVWEERKPYKTLQAQAPEKSKNKKKQRK-- 340

  Fly   225 IGDSQLSTFAAGLVTPQASRTSLEPFIVGYFNGPELLVKIQKLRF-KRDLEKRRAGGGSPPPPPP 288
                                            ||..  |.|.|:| ::.|:|.|.          
Human   341 --------------------------------GPHR--KSQTLQFDEQTLKKARR---------- 361

  Fly   289 PPVDLYRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLM 353
               ..:..|::|.|....|||.::....|:|:||.|:||:|.|.|.||:...:..:|||.:|:::
Human   362 ---KQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIV 423

  Fly   354 HL--KQPHLPKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399
            ..  ..|.:|:|||||..:.:::||.:.....:.|..|.....:.|.|
Human   424 RAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCAC 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 44/244 (18%)
TGFB 300..400 CDD:214556 34/102 (33%)
BMP3NP_001192.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..53
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..350 7/65 (11%)
TGF_beta_BMP3 363..472 CDD:381663 35/109 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.