DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and Inhbc

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_072136.1 Gene:Inhbc / 64549 RGDID:621194 Length:351 Species:Rattus norvegicus


Alignment Length:376 Identity:78/376 - (20%)
Similarity:128/376 - (34%) Gaps:102/376 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 FLLEVYNEISEDQEPKEVLHQRH----------------------KRSLDDDILISNEDRQEIAS 109
            |.||.:.|:..|...|.:|.:.|                      .|....:.|:.::.|||.  
  Rat    34 FDLESHRELLLDLAKKSILDKLHLSQRPILSRPVSREALKTALRRLRGTRAETLLEHDQRQEY-- 96

  Fly   110 CNSILTFSSRLKPEQLDNELDMHITFNTNDVPVDLSLVQAMLRIYKQ-PSLVDRRANFTVSVYRK 173
              .|::|:...........|:.|.:..|..   .:.::|.....:.| |....:..|..|.|.|.
  Rat    97 --EIISFADTGLSNINQTRLEFHFSDRTTG---GVEVLQTRFMFFMQLPPNTTQTMNIRVLVLRP 156

  Fly   174 LDNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRYWLHNKGLQRRNELRISIGDSQLSTFAAGLV 238
            .|.                        |||.|.:|.|.   :......::.:|....:..:.|.:
  Rat   157 YDT------------------------NLTLTSQYMLQ---VDASGWYQLLLGPEAQAACSQGHL 194

  Fly   239 T------PQASRTSL-------EPFIVGYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPP 290
            |      .|.:.:||       .||:..            ::|.:.....||.|           
  Rat   195 TLELVPESQLAHSSLILDGVSHRPFVAA------------QVRVEGKHRVRRRG----------- 236

  Fly   291 VDLYRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTK----MNATNHAIVQT 351
            ::.....:.|.|..|.|||:|:..|:|:|.|:.:...||.|.|  ||...    ::|:.|..|..
  Rat   237 INCQGLSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCTGQC--PLHVAGMPGISASFHTAVLN 299

  Fly   352 LMHLKQ---PHLPKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399
            |:....   ......|||||....:::|.|..:..|..|.....|.:.|||
  Rat   300 LLKANTDAGTARRGSCCVPTSRRPLSLLYYDRDSNIVKTDIPDMVVEACGC 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 40/222 (18%)
TGFB 300..400 CDD:214556 34/107 (32%)
InhbcNP_072136.1 TGF_beta_INHBC_E 246..351 CDD:381676 34/107 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.