DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and bmp7.2

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:XP_017947617.1 Gene:bmp7.2 / 619363 XenbaseID:XB-GENE-855954 Length:436 Species:Xenopus tropicalis


Alignment Length:431 Identity:128/431 - (29%)
Similarity:215/431 - (49%) Gaps:56/431 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTSLFY----AASATTYVTTNNHI-----EMPIYQKRPLSEQMEMIDILDLGDRPRRQAEPNLHN 62
            |..|||    :.|:.|.:..:.|.     .:..:::|.:  |.|::.||.|..|||... |....
 Frog    25 LLFLFYISLSSISSNTILENDFHSSFVQRRLKGHERREI--QKEILTILGLQHRPRPYL-PEKKK 86

  Fly    63 SASKFLLEVYNEIS-EDQEPKEVLHQRHKRSLDD-DILISNEDRQEIASCNSILTFSSRLKPEQL 125
            ||..|::::||.:: ||...::|.:.....||:: ..|.::::...:|..:::::|::.:   :.
 Frog    87 SAPLFMMDLYNAVNIEDLNAEDVSYFNKPVSLNEHSSLATDQENDFLAHADTVMSFANLV---EN 148

  Fly   126 DNEL---DMHITFNTNDVPVDLSLVQAMLRIYKQPSLVDRRANFTVSVYRKLDNRQD---FSYRI 184
            ||||   .....|:..|:|:...|..|..||||  ..|:....:.|:||:.|..:.|   :.:::
 Frog   149 DNELYKNRQKFKFDLTDIPLGDELTAAEFRIYK--DYVENNETYQVTVYQVLQKQYDKEPYLFQV 211

  Fly   185 LGSVNTTSSQRGWLEFNLTDTLRYWL----HNKGLQRRNELRI------SIGDSQLSTFAAGLVT 239
             .|.....:::|||.|::|.|..:|:    :|.|||    |.|      |:....:..|  |...
 Frog   212 -DSRTIWGTEKGWLTFDITATSNHWVINPHYNLGLQ----LSIESMDMQSVNPRHVGLF--GRNG 269

  Fly   240 PQASRTSLEPFIVGYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPP--PPPPPVDLYRP------ 296
            ||    ..:||:|.:|...|:.::..:....:...:.||.......  ||....|...|      
 Frog   270 PQ----DKQPFMVAFFKTSEIHLRSIRSTSNKHWNQERAKTYKEQDNFPPANISDGIMPTAKRRF 330

  Fly   297 -PQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQPH- 359
             .|:|::....|.|::|...:|:|||:.:.||:|.|.|.|||.:.||||||||||||:|...|. 
 Frog   331 FKQACKKHELFVSFRDLGWQDWIIAPEGYAAYYCDGECAFPLNSFMNATNHAIVQTLVHFVNPET 395

  Fly   360 LPKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGCH 400
            :|||||.||.|..|::|.:.:...:.|.||:..|.:.||||
 Frog   396 VPKPCCAPTQLNGISVLYFDDSSNVILKKYKNMVVQACGCH 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 63/232 (27%)
TGFB 300..400 CDD:214556 46/100 (46%)
bmp7.2XP_017947617.1 TGFb_propeptide 44..280 CDD:395559 65/254 (26%)
TGF_beta_BMP7 330..436 CDD:381667 47/105 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1063560at2759
OrthoFinder 1 1.000 - - FOG0000576
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X157
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.