DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and Gdf9

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_067704.1 Gene:Gdf9 / 59304 RGDID:71038 Length:440 Species:Rattus norvegicus


Alignment Length:444 Identity:82/444 - (18%)
Similarity:152/444 - (34%) Gaps:138/444 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VFFLTSLF--YAASATTYVTTNNHIEMPIYQKRPLSEQ-----------MEMIDILDLGDRPRRQ 55
            ::::..|:  ||........:.:|:...:....|.::|           :.|:|:|...||....
  Rat    86 LYYMKKLYKTYATKEGVPKPSRSHLYNTVRLFSPCAQQEQAPSNQMTGPLPMVDLLFNLDRVTAM 150

  Fly    56 AE-------PNLHNSASKFL-------LEVYNEISED----QEPKEVLHQRHKRSLDDDILISNE 102
            ..       ..|:|||:...       |.|...:|..    :.|.....::| |.::.|:     
  Rat   151 EHLLKSVLLYTLNNSAASSSTVTCVCDLVVKEPMSSSKATPRAPYSFTLRKH-RWIEMDV----- 209

  Fly   103 DRQEIASCNSILTFSSRLKPEQLDNELDMHITFN---TNDVPVDLSLVQAMLRIYKQPSLVDRRA 164
                          :|.|:|....:|..:|::.|   |.|...:.......|.:  .|||:    
  Rat   210 --------------TSLLQPLVASSERSIHLSVNFTCTRDQAPENGTFNMPLSV--PPSLI---- 254

  Fly   165 NFTVSVYRKLDNRQDFSYRILGSVNTTSSQ--RGWLEFNLTDTLRYWLHNKGLQRRNELRISIGD 227
                 :|                :|.||:|  ..|.  :|..|.|:..|.             |.
  Rat   255 -----LY----------------LNDTSTQAYHSWQ--SLQSTQRHSQHP-------------GQ 283

  Fly   228 SQLSTFAAGLVTPQASRTSLEPFIVGYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPV- 291
            ..::|..   |..:|:.....|                         :.|.|..:.......|: 
  Rat   284 DSVTTRP---VEEEATEVERSP-------------------------RHRRGQKTLSSETKKPLT 320

  Fly   292 ------DLYR----PPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNH 346
                  :.:|    |...||..:|.:.|.:|...||::||.::...:|.|.|...:..:..:..|
  Rat   321 ASFNLSEYFRQFLFPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVRHRYGSPVH 385

  Fly   347 AIVQTLMHLK-QPHLPKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399
            .:||.:::.| .|.:|:|.|||.....:::|....:..|...:|:..:|..|.|
  Rat   386 TMVQNIIYEKLDPSVPRPSCVPGKYSPLSVLTIEPDGSIAYKEYEDMIATRCTC 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 44/248 (18%)
TGFB 300..400 CDD:214556 28/101 (28%)
Gdf9NP_067704.1 TGF_beta 337..439 CDD:278448 27/101 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.