DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and Bmp15

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_067702.1 Gene:Bmp15 / 59302 RGDID:70990 Length:391 Species:Rattus norvegicus


Alignment Length:391 Identity:88/391 - (22%)
Similarity:153/391 - (39%) Gaps:62/391 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LSEQMEMIDILDLG-DRPRRQAEPNLHNSASKFLLEVYNEISEDQEPKEVLHQRHKRSLDDDILI 99
            |:|...:...|||. :.|.::.:........:::|::|...::...     |.|..|::...:: 
  Rat    35 LAENPTLPSSLDLAKEAPGKEMKQWPQGYPLRYMLKLYQRSADPHG-----HPRENRTIGAKMV- 93

  Fly   100 SNEDRQEIASCNSILTFSSRLKPEQLDNEL---DMHITFNTNDVP-----VDLSLVQAMLRIYKQ 156
                              ..:||......|   ..||  .|.|.|     |...|::|.:....|
  Rat    94 ------------------RLIKPSASAMRLLRGPWHI--QTLDFPLASNEVAYQLIRATVVYRHQ 138

  Fly   157 PSLVDRRANFTVSVYRKLDNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRYWLHNKGLQRRNEL 221
            ..||....:..|..:......:.|..: .||...:|..:.|.|.|:|..::..|.|:..:|...|
  Rat   139 LHLVHYHLSCHVEPWVPKCRTKHFPSK-SGSAKPSSVSKAWREMNITHCIQQKLWNRKGRRVLRL 202

  Fly   222 RISI----GDSQLSTFAAGLVTPQASRTSLE-PFIVGYFNGPELLVKIQKL-RFKRDLEKRRA-- 278
            |...    |:..|.....|:       |||: .|::.||:..:...:.:.| |.:.:|..|.:  
  Rat   203 RFMCQQQKGNETLELRWHGM-------TSLDVAFLLLYFDDTDESAQAKLLARGQEELTDRESPF 260

  Fly   279 ---------GGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCN 334
                     ...|..|.|....|.....| |....:.|.|.:|...:|:|||:.:...:|.|.|.
  Rat   261 LMRSVRQTCSIASDVPCPSQEQDRSVNNQ-CSLHPYKVSFHQLGWDHWIIAPRLYTPNYCKGICT 324

  Fly   335 FPLGTKMNATNHAIVQTLMH-LKQPHLPKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECG 398
            ..|...:|:.||||:|:|:: |....:|:..|||.....::||.......|...:|:..:|:.|.
  Rat   325 GVLPYGLNSPNHAIIQSLVNELVNRSVPQLSCVPYKFLPMSILLIEANGSILYKEYEGMIAQSCT 389

  Fly   399 C 399
            |
  Rat   390 C 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 44/228 (19%)
TGFB 300..400 CDD:214556 31/101 (31%)
Bmp15NP_067702.1 TGF_beta 288..390 CDD:278448 31/102 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.