DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and Tgfb1

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_067589.1 Gene:Tgfb1 / 59086 RGDID:69051 Length:390 Species:Rattus norvegicus


Alignment Length:426 Identity:89/426 - (20%)
Similarity:161/426 - (37%) Gaps:102/426 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AASATTYVTTNNHIEMPIYQKRPLSE-QMEMIDILDLGDRPRRQAEPNLHNSASKFLLEVYNEI- 75
            ||..:|..|    |:|.:.:::.:.. :.:::..|.|...|.:...|  .....:.:|.:||.. 
  Rat    27 AAGLSTCKT----IDMELVKRKRIEAIRGQILSKLRLASPPSQGEVP--PGPLPEAVLALYNSTR 85

  Fly    76 ------SEDQEPKEVLHQRHKRSLDDDILISNEDRQEIASCNSILTFSSRLKPEQLDNELDMHIT 134
                  |.|.||:.          :.|.......|..:...|:.:...::      |....:::.
  Rat    86 DRVAGESADPEPEP----------EADYYAKEVTRVLMVDRNNAIYDKTK------DITHSIYMF 134

  Fly   135 FNTND----VPVDLSLVQAMLRIYKQPSLVDRRANFTVSVYRKLDNRQDFSYRILGS-VNTTSSQ 194
            |||:|    ||....|.:|.||:.:..|.|::.    |.:|:|..|.   |:|.||: :.|.:..
  Rat   135 FNTSDIREAVPEPPLLSRAELRLQRFKSTVEQH----VELYQKYSNN---SWRYLGNRLLTPTDT 192

  Fly   195 RGWLEFNLTDTLRYWLH-NKGLQ------------RRNELRISIGDSQLSTFAAGLVTPQASRTS 246
            ..||.|::|..:|.||: ..|:|            :.|.|.:.|..          ::|: .|..
  Rat   193 PEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNVLHVEING----------ISPK-RRGD 246

  Fly   247 L-------EPFIVGYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDLYRPPQSCERLN 304
            |       .||::......|....:...|.:|.|:.......:              .::|....
  Rat   247 LGTIHDMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSST--------------EKNCCVRQ 297

  Fly   305 FTVDFKELHMHNWVIAPKKFEAYFCGGGCNF--PLGTKMNATNHAIVQTLMHLKQPHLP----KP 363
            ..:||::.....|:..||.:.|.||.|.|.:  .|.|:.:        .::.|...|.|    .|
  Rat   298 LYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYS--------KVLALYNQHNPGASASP 354

  Fly   364 CCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399
            ||||..|..:.|:.|:... ..:.:....:.:.|.|
  Rat   355 CCVPQALEPLPIVYYVGRK-PKVEQLSNMIVRSCKC 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 53/246 (22%)
TGFB 300..400 CDD:214556 26/106 (25%)
Tgfb1NP_067589.1 TGFb_propeptide 30..261 CDD:395559 57/270 (21%)
Straightjacket domain. /evidence=ECO:0000250|UniProtKB:P07200 30..74 8/49 (16%)
Arm domain. /evidence=ECO:0000250|UniProtKB:P07200 75..271 50/229 (22%)
Bowtie tail. /evidence=ECO:0000250|UniProtKB:P01137 226..252 6/36 (17%)
Cell attachment site. /evidence=ECO:0000255 244..246 1/1 (100%)
TGF_beta_TGFB1 292..390 CDD:381654 26/107 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.