DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and tgfb1b

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:XP_692338.3 Gene:tgfb1b / 563884 ZFINID:ZDB-GENE-091028-1 Length:379 Species:Danio rerio


Alignment Length:409 Identity:89/409 - (21%)
Similarity:168/409 - (41%) Gaps:82/409 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VTTNNHIEMP-IYQKRPLSEQMEMIDILDLGDRPRRQAEPNLHNSASKFLLEVYN---EISEDQE 80
            ::|.|.:::. |.:||..:.:.:::..|.|...|..:.:..:.|..:: |:.|||   |::|:|.
Zfish    23 LSTCNPLDLELIKRKRIEAIRGQILSKLRLPKEPEVEEKELIENIPAE-LISVYNSTMELNEEQA 86

  Fly    81 PKEVLHQRHKRSLDDDILISNEDRQEIASCNSILTFS-SRLKPEQLDNELDMHITFNTNDVPVDL 144
            ...|.|     :::|       ..:|......|..|: ...|||:       ::.||..|:...|
Zfish    87 ANPVQH-----TIED-------PTEEEYYAKEIHKFTMMEEKPEK-------YLVFNITDIKHKL 132

  Fly   145 S----LVQAMLRI-YKQPSLVDRRANFTVSVYRKLDNRQDFSYRILGSVNTTSSQRGWLEFNLTD 204
            .    |.||..|: .|:|.:.|....  :.:|:...|:..:......|:.|...   |:.|::|.
Zfish   133 GANHVLYQAEFRLRIKEPKMGDSEQR--LELYQVTGNKSRYLNSRFISLQTAGK---WVSFDVTS 192

  Fly   205 TLRYWLHNKGLQRRNELRISIG---DSQLSTFA------------AGLVTPQASRTSLEPFIVGY 254
            ||:.||.....::..:|:::..   :||.:.|.            .||:..|.::    |:|: .
Zfish   193 TLKDWLQMPEEKQEFQLQLACSCKPESQNTEFLFKIAGLSRNRGDTGLLADQVAK----PYIL-V 252

  Fly   255 FNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWVI 319
            .:.|.......|.|.||:.:               .|...:....|.| :..:||::.....|:.
Zfish   253 MSHPADGHSPAKSRRKRETD---------------AVCTEKSEGCCVR-SLYIDFRKDLGWKWIH 301

  Fly   320 APKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQPHLP----KPCCVPTVLGAITILRYLN 380
            .|..:.|.:|.|.|:: :.|..|..:..:.     |.:.|.|    :|||||.||..:.|:.|:.
Zfish   302 EPSGYYANYCTGSCSY-VWTSENKYSQVLA-----LYRHHNPGASAQPCCVPQVLDPLPIIYYVG 360

  Fly   381 EDIIDLTKYQKAVAKECGC 399
            .. ..:.:....:.|.|.|
Zfish   361 RQ-HKVEQLSNMIVKTCKC 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 51/238 (21%)
TGFB 300..400 CDD:214556 27/104 (26%)
tgfb1bXP_692338.3 TGFb_propeptide 22..253 CDD:279078 56/259 (22%)
TGF_beta 280..378 CDD:278448 26/105 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.