DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and gdf2

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001165057.2 Gene:gdf2 / 563287 ZFINID:ZDB-GENE-100107-1 Length:389 Species:Danio rerio


Alignment Length:392 Identity:88/392 - (22%)
Similarity:164/392 - (41%) Gaps:105/392 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LDLGDRPR--RQAEPNLHNSASKFLLEVYNEISEDQEP------------KEVLHQRHKRSLDDD 96
            |:|...|:  |:.:|      .:|::|:||..:.|:..            ::|::...:.:....
Zfish    64 LNLSGVPQEHRKVQP------PQFMIELYNRYASDKNSIPRSDVIRSFVVQDVIYSIRQGNKTQH 122

  Fly    97 ILISN---EDRQEIASCN-SILTFSSRLKPEQLDNELDMHITFNTNDVPVDLSLVQAMLRIYKQP 157
            .|:.|   .:.:||.|.. .:.|...|.|| ..|   |:..:.|..||.            |:| 
Zfish   123 RLLFNVSIPNHEEITSVQLRLFTLWHRHKP-ACD---DLFTSINVYDVE------------YEQ- 170

  Fly   158 SLVDRRANFTVSVYRKLDNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRYWLHNKGLQRRNELR 222
                     ...:...||.|.     :..|:||      |..|::|..:|.|  ::..:...|::
Zfish   171 ---------NAKILHLLDGRD-----VRESINT------WEAFDVTGAVRIW--HESRRGAGEIQ 213

  Fly   223 ISIGDSQLSTFAAGLVTPQASRTSLEPFIVGYFNGPELLV---------KIQKLRFKRDL---EK 275
            :.:..| ..:|...|        |||.      |...:::         |.:.:|..:::   |:
Zfish   214 VEVQHS-CDSFDISL--------SLED------NSSAVVIVFSDDLGNRKEESMRKVKEMLVREQ 263

  Fly   276 RRAGGGSPPPPPPPPVDLYRPPQS------CERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCN 334
            ::.|..:|..      :.:|..:.      |.|.:..|:||::....|::||.:::||.|.|.|.
Zfish   264 QQVGNQAPVS------NRHRRRKRKAKNNYCRRTSLKVNFKDIGWDKWIVAPPEYDAYECKGVCY 322

  Fly   335 FPLGTKMNATNHAIVQTLMHLKQPHLPK-PCCVPTVLGAITILRYLNEDIIDLTK-YQKAVAKEC 397
            |||...::.:.||::|||::|..|.... .|||||.|..|.:: |..:.:|.:.. |::....:|
Zfish   323 FPLTDDVSPSRHAVIQTLVNLSNPKKANMACCVPTKLDPIAVM-YQEKGVITVRHLYEEMKVAKC 386

  Fly   398 GC 399
            ||
Zfish   387 GC 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 45/225 (20%)
TGFB 300..400 CDD:214556 36/102 (35%)
gdf2NP_001165057.2 TGFb_propeptide 60..222 CDD:279078 40/203 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..284 3/26 (12%)
TGF_beta 288..388 CDD:278448 34/100 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.