DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and gdf10a

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:XP_691459.3 Gene:gdf10a / 563003 ZFINID:ZDB-GENE-090312-17 Length:441 Species:Danio rerio


Alignment Length:140 Identity:41/140 - (29%)
Similarity:71/140 - (50%) Gaps:16/140 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 KIQKLRF-KRDLEKRRAGGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWVIAPKKFEA 326
            |.|.||| ::.::|.|.             ..::.|:||.|....|||.::..:.|:::||.|:|
Zfish   314 KSQVLRFDEKTMKKARR-------------RQWKEPRSCSRRYLKVDFADIGWNEWILSPKSFDA 365

  Fly   327 YFCGGGCNFPLGTKMNATNHAIVQTLMHLKQ--PHLPKPCCVPTVLGAITILRYLNEDIIDLTKY 389
            ::|.|.|.||:...:..:|||.:|:::....  |.:|:|||||..:..:::|.......|.|..|
Zfish   366 FYCAGTCEFPIPKVVRPSNHATIQSIVKAVGIIPGIPEPCCVPEKMKPLSVLFVDESKNIVLKIY 430

  Fly   390 QKAVAKECGC 399
            .....:.|.|
Zfish   431 PNMSVETCAC 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078
TGFB 300..400 CDD:214556 32/102 (31%)
gdf10aXP_691459.3 TGF_beta 337..440 CDD:278448 32/102 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.