DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and inhbab

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001018166.1 Gene:inhbab / 553816 ZFINID:ZDB-GENE-050525-2 Length:405 Species:Danio rerio


Alignment Length:330 Identity:80/330 - (24%)
Similarity:117/330 - (35%) Gaps:96/330 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 RLKPEQLDNELDMHITF-NTNDVP----VDLSLVQAMLRIYKQPSLVDRRANFTVSVYRKLDNRQ 178
            |.:||:...|:   ||| ...|.|    .|:|...:.|.:.:|       ||  |.::.|:..  
Zfish   122 REQPEEQPFEI---ITFAEPGDAPDVLKFDISKEGSTLSVVEQ-------AN--VWLFLKVAK-- 172

  Fly   179 DFSYRILGSVNTTSSQRGWLEFNLT-------------DTLRYWLHNKGLQRRNELRISIGDSQL 230
              ..|:.|.|:....|.|..:...|             ||.|...|...:.|..:..:. |||.|
Zfish   173 --GSRVKGKVSVQLLQNGKADSGSTDRPEDQVVSEKTIDTRRSGWHTLPVPRTVQTLLD-GDSSL 234

  Fly   231 STFAAGLVTPQASRTSLEPFIV----------GYFNGPELLVKI------QKLRFKRDLE---KR 276
            .:....  .|..:.....|.:|          ...:.|.|:|.:      |..|.||.||   |.
Zfish   235 LSLRVS--CPMCAEAGAVPILVPAEGNKVKEREQSHRPFLMVVLKPAEEHQHRRSKRGLECDGKI 297

  Fly   277 RAGGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGC-------- 333
            |.                     |.:..|.|:||::...:|:|||..:.|.:|.|.|        
Zfish   298 RV---------------------CCKRQFYVNFKDIGWSDWIIAPSGYHANYCEGDCPSHVASIT 341

  Fly   334 NFPLGTKMNATNHAIVQTLMHLKQPHLP----KPCCVPTVLGAITILRYLNEDIIDLTKYQKAVA 394
            ...|.......||       :..:.:.|    |.|||||.|.|:::|.|..|..|.....|..:.
Zfish   342 GSALSFHSTVINH-------YRMRGYSPFNNIKSCCVPTRLRAMSMLYYNEEQKIIKKDIQNMIV 399

  Fly   395 KECGC 399
            .||||
Zfish   400 DECGC 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 35/162 (22%)
TGFB 300..400 CDD:214556 34/112 (30%)
inhbabNP_001018166.1 TGFb_propeptide 64..272 CDD:279078 36/168 (21%)
TGF_beta 298..404 CDD:278448 33/133 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.