DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and nodal1

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001016321.1 Gene:nodal1 / 549075 XenbaseID:XB-GENE-487169 Length:403 Species:Xenopus tropicalis


Alignment Length:326 Identity:90/326 - (27%)
Similarity:144/326 - (44%) Gaps:69/326 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LDNELDMHITFNTNDVPVDLSLVQAMLRIYKQPSLVDRRANFTVSVYRKLDNRQDFSYRILGSVN 189
            :::|....::|:.:.|.....|..|.|||  |...::...|.||.||...|..::.   .|||..
 Frog    95 MESEKRWTLSFDMSAVSKSSELKLAELRI--QLPHIEMSHNVTVDVYHTRDGEENL---YLGSFE 154

  Fly   190 TTS-SQRG--WLEFNLTDTLRY-----------WLHNKGLQRRN------ELRISIGDS------ 228
            ... |.:|  |..||:|..|::           :|..|....|.      |...|.|||      
 Frog   155 ANPFSTKGSPWKVFNVTRILQHYFKEGQDIKSEYLRTKDRAERGSGMSSAEFLDSPGDSPQYNPH 219

  Fly   229 ------QLSTFAAGLVTPQASRTSLEPFI--VGYFNGPELL--------VKIQKL-------RFK 270
                  .|||....||.    .|.::|.:  :|:   |.|:        |.::|.       |.:
 Frog   220 HTPLRRYLSTEGVMLVL----FTKVKPSVNHIGF---PSLIKTAESSKYVDMEKASRMPGIRRHR 277

  Fly   271 RDL-EKRRAGGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCN 334
            |:. ||.....||   .|...||..:|  .|.|::..|:|:::...||::.|||:.||.|.|.|.
 Frog   278 RNKNEKHHLSMGS---IPSRHVDNGKP--LCRRVDMIVNFEDIGWGNWIVYPKKYNAYRCEGACP 337

  Fly   335 FPLGTKMNATNHAIVQTLMHLKQPH-LPKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECG 398
            .||......||||.:::::.|.||. :..|.|||..:..:::|.|..:::: |..:|:.:.:|||
 Frog   338 IPLNETFKPTNHAYMKSVVKLYQPEKVECPLCVPIKMSPLSMLYYEGDEVV-LRHHQEMIVEECG 401

  Fly   399 C 399
            |
 Frog   402 C 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 40/162 (25%)
TGFB 300..400 CDD:214556 35/101 (35%)
nodal1NP_001016321.1 TGFb_propeptide 46..218 CDD:279078 33/127 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..220 6/24 (25%)
TGFB 303..403 CDD:214556 35/101 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.