DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scw and gdf11

DIOPT Version :9

Sequence 1:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_998140.1 Gene:gdf11 / 406247 ZFINID:ZDB-GENE-040427-2 Length:390 Species:Danio rerio


Alignment Length:422 Identity:100/422 - (23%)
Similarity:151/422 - (35%) Gaps:119/422 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PLSEQMEMI--DILDLGDRPRRQAEPNLHNSASKFL----------------------LEVYNEI 75
            ||||....|  .:.|:.|....:....:....||.|                      .||.|::
Zfish    30 PLSEMSSDIGVSLFDVDDVESSECSACVWREQSKVLRLETIKSQILSKLRLKQAPNISREVVNQL 94

  Fly    76 SEDQEPKEVLHQRH-----KRSLDDDILISNEDRQEI-ASCNSILTFSSRLKPEQLDNELDMHIT 134
            .....|.:.|...|     ..||:|.|     |..|. |:..|::|.:|  :||.| .::|...|
Zfish    95 LPKAPPLQQLLDHHDFQGDASSLEDFI-----DADEYHATTESVITMAS--EPEPL-VQVDGKPT 151

  Fly   135 ---FNTNDVPVDLSLVQAMLRIYKQPSLVDRRANFTVSVY------RKLDNRQDFSYRILGSVNT 190
               |..:...:...:::|.|.:|.||      ...|.:||      :.:..:.....||......
Zfish   152 CCFFKFSPKLMFTKVLKAQLWVYLQP------LKQTSTVYLQILRLKPITEQGSRHIRIRSLKIE 210

  Fly   191 TSSQRG-WLEFNLTDTLRYWLH----NKGL------QRRNELRI-SIGDSQLSTFAAGLVTPQAS 243
            ..||.| |...:....|:.|..    |.|:      :..|:|.: |:|..:              
Zfish   211 LDSQAGHWQSIDFKHVLQNWFKQPHTNWGIDINAYDESGNDLAVTSLGPGE-------------- 261

  Fly   244 RTSLEPFIVGYFNGPELLVKIQKL--RFKRDLEKRRAGGGSPPPPPPPPVDLYRPPQSCERLNFT 306
             ..|:||         |.|||.:.  |.:|:|..              ..|.:.....|.|...|
Zfish   262 -EGLQPF---------LEVKILETTKRSRRNLGL--------------DCDEHSTESRCCRYPLT 302

  Fly   307 VDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQPHLPK----PCCVP 367
            ||| |....:|:||||:::|.:|.|.|.:....|...|         ||.|...|:    |||.|
Zfish   303 VDF-EAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHT---------HLVQHANPRGSAGPCCTP 357

  Fly   368 TVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399
            |.:..|.:|.:.::..|...|....|...|||
Zfish   358 TKMSPINMLYFNDKQQIIHGKIPGMVVDRCGC 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 53/265 (20%)
TGFB 300..400 CDD:214556 35/104 (34%)
gdf11NP_998140.1 TGFb_propeptide 52..268 CDD:279078 50/253 (20%)
TGFB 296..390 CDD:214556 35/104 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.